Property Summary

NCBI Gene PubMed Count 421
Grant Count 528
R01 Count 287
Funding $80,235,410.38
PubMed Score 222.49
PubTator Score 1246.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P05107 B3KTS8 D3DSM1 Q16418 Q53HS5 Q9UD72
Symbols LAD
CD18
MF17
MFI7
LCAMB
LFA-1
MAC-1

Gene

PDB

2JF1   5E6R   5E6S   5E6U   3K6S   3K71   3K72   4NEH   4NEN   5ES4   1JX3   1L3Y   1YUK   2P26   2P28   2V7D   5E6V   5E6W   5E6X  

Gene RIF (350)

PMID Text
26936951 Rerefined beta2 integrin structures show pyroglutamic acid at the beta2 N terminus and bending within the EGF1 domain. Allostery is relayed to the alphaI domain by an internal ligand binding to a pocket at the interface between the beta-propeller and betaI domains.
26889827 specific LFA-1 binding partners that may play a role in regulating LFA-1 activity in dendritic cells.
26849368 The blood levels of CD18 soluble form were decreased in chronic rheumatoid arthritis patients.
26639818 genetic polymorphism is associated with leukocyte adhesion deficiency type 1 in Iranian families
26563750 The expression level of Mac-1 correlated with the number of neutrophils in patients with serous, endometrioid and undifferentiated epithelial ovarian cancer.
26498406 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration
26497373 Four new mutations in the ITGB2 gene were found. These results can be used for decisive genetic diagnosis, genetic counseling, as well as prenatal diagnosis for all patients who are suspended to Leukocyte adhesion deficiency type I (LAD-I).
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26293614 Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs.
More...

AA Sequence

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM      1 - 70
RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML     71 - 140
DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL    141 - 210
TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT    211 - 280
PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS    281 - 350
NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC    351 - 420
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS    421 - 490
QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG    491 - 560
KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE    561 - 630
CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN    631 - 700
IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES     701 - 769
//

Text Mined References (429)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26936951 2016 Leukocyte integrin ?L?2 headpiece structures: The ?I domain, the pocket for the internal ligand, and concerted movements of its loops.
26889827 2016 Proteome Based Construction of the Lymphocyte Function-Associated Antigen 1 (LFA-1) Interactome in Human Dendritic Cells.
26849368 2016 Changes in Soluble CD18 in Murine Autoimmune Arthritis and Rheumatoid Arthritis Reflect Disease Establishment and Treatment Response.
26639818 2016 Mutation spectra of the ITGB2 gene in Iranian families with leukocyte adhesion deficiency type 1.
26563750 2016 Heterogeneity of the Mac-1 expression on peripheral blood neutrophils in patients with different types of epithelial ovarian cancer.
26498406 2016 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration.
26497373 2015 Investigation of ITGB2 gene in 12 new cases of leukocyte adhesion deficiency-type I revealed four novel mutations from Iran.
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
More...