Property Summary

NCBI Gene PubMed Count 421
PubMed Score 222.49
PubTator Score 1246.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Tear film insufficiency 14
Disease Target Count Z-score Confidence
Leukocyte adhesion deficiency 15 6.41 3.2
Disease Target Count
Leukocyte adhesion deficiency 1 1

Expression

  Differential Expression (30)

Disease log2 FC p
chronic lymphosyte leukemia -2.700 3.0e-10
malignant mesothelioma 2.500 3.8e-08
cutaneous lupus erythematosus 1.500 2.7e-03
glioblastoma 3.000 3.5e-04
osteosarcoma -3.129 1.1e-03
posterior fossa group A ependymoma 1.300 2.6e-05
astrocytoma 3.100 1.6e-03
medulloblastoma, large-cell -1.500 3.6e-03
Duchenne muscular dystrophy 1.201 2.4e-09
tuberculosis 1.600 3.0e-07
intraductal papillary-mucinous adenoma (... -1.300 1.1e-02
intraductal papillary-mucinous carcinoma... -1.300 1.6e-02
lung cancer -2.600 7.3e-06
breast carcinoma 1.900 1.1e-03
interstitial cystitis 2.000 2.5e-03
pediatric high grade glioma 1.800 1.0e-03
pilocytic astrocytoma 1.800 1.0e-08
primary Sjogren syndrome 1.700 3.0e-04
subependymal giant cell astrocytoma 2.182 9.6e-03
inflammatory breast cancer 1.300 3.3e-02
invasive ductal carcinoma 1.918 1.0e-04
lung carcinoma -2.300 3.4e-25
gastric carcinoma 1.800 3.1e-02
acute myeloid leukemia 1.200 2.9e-02
ulcerative colitis 2.600 3.8e-07
ovarian cancer 2.500 2.3e-05
Down syndrome 1.500 2.5e-03
dermatomyositis 1.200 1.0e-02
head and neck cancer -1.100 1.3e-02
head and neck cancer and chronic obstruc... 1.300 2.6e-03

Protein-protein Interaction (12)

Gene RIF (349)

PMID Text
26936951 Rerefined beta2 integrin structures show pyroglutamic acid at the beta2 N terminus and bending within the EGF1 domain. Allostery is relayed to the alphaI domain by an internal ligand binding to a pocket at the interface between the beta-propeller and betaI domains.
26889827 specific LFA-1 binding partners that may play a role in regulating LFA-1 activity in dendritic cells.
26849368 The blood levels of CD18 soluble form were decreased in chronic rheumatoid arthritis patients.
26639818 genetic polymorphism is associated with leukocyte adhesion deficiency type 1 in Iranian families
26563750 The expression level of Mac-1 correlated with the number of neutrophils in patients with serous, endometrioid and undifferentiated epithelial ovarian cancer.
26498406 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration
26497373 Four new mutations in the ITGB2 gene were found. These results can be used for decisive genetic diagnosis, genetic counseling, as well as prenatal diagnosis for all patients who are suspended to Leukocyte adhesion deficiency type I (LAD-I).
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26293614 Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs.
26283883 integrinbeta1, beta2 and beta3 are increased in patients with acute infection, which might explain the increased risk of venous thromboembolism in acute infection patients
26231039 Contact-dependent lung adenocarcinoma aggregate dispersion by M2a macrophages occurs via ICAM-1 and beta2 integrin interactions.
26216891 Data show that interleukin-18 was involved in the eosinophil-mediated death of colon carcinoma cells via upregulation of CD11a/CD18 and ICAM-1 adhesion molecules.
26188538 Kindlin-3/FERMT3 is upregulated in atherosclerotic, mainly in cells of monocytic origin and of M2 type. Simultaneous upregulation of ITGB2 suggests a synergistic effect on leukocyte adherence and transmigration into the vessel wall.
26143530 Stable clutch formation was observed for Mn(2+)-induced high affinity LFA-1, but was not required for physiological adhesion
26108885 Data show that residues Ser745 and Ser756 in the integrin beta2 tail, which are adjacent to the NxxF motif, are required for docking protein 1, docking protein 1, 62kDa (downstream of tyrosine kinase 1) (Dok1) interaction.
26003300 The mechanism responsible for this negative regulation exerted by CD9 on LFA-1 adhesion does not involve changes in the affinity state of this integrin but seems to be related to alterations in its state of aggregation.
25884075 The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1.
25850729 In addition to LFA-1, this work reveals a second surface protein, Fas, that is critical for LtxA-mediated cell death.
25825444 the coordinated expression of LFA-1 and DNAM-1 is a central component of NK cell education and provides a potential mechanism for controlling cytotoxicity by functionally mature NK cells.
25703682 Nine novel mutations in CD18 in 15 patients and 11 known mutations in 16 patients with leukocyte adhesion deficiency-I were detected.
25684021 Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells.
25678252 the blocking of LFA-1/ICAM-1 interaction resulted in a significant increase in the percentage of IL-17(+) T cells expanded in nonclassical monocyte/T-cell cocultures
25666810 The data provide direct support for a model in which the T cell actin network generates mechanical forces that regulate LFA-1 activity at the immunological synapse.
25640842 Our results showed that alphaLbeta2 with alphaM calf-1 domain completely lost the response to Mg/EGTA activation.
25624455 PTPRG is a JAK2 phosphatase that negatively regulates leukocyte integrin beta2 activation.
25613106 newly revealed recognition specificity of alpha(M)beta2 toward unfolded protein segments and cationic proteins and peptides suggests that alpha(M)beta2 may serve as a previously proposed "alarmin" receptor with important roles in innate host defense
25554420 Examination of CR3 ( CD11b/CD18) mutant variants and mass spectrometry analysis of the N-glycosylation pattern of CR3 revealed that N-glycans located in the C-terminal part of the CD11b subunit are involved in binding and cytotoxic activity of CyaA.
25514840 16 novel missense mutations in the beta2 integrin subunit have been characterized.
25461401 Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3).
25365491 Role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli
25341726 The level of LFA-1 expression on allergic asthma patient peripheral blood mononuclear cells (PBMCs) was greater than on healthy PBMCs.
25292215 A signaling network stimulated by beta2 integrin promotes the polarization of lytic granules in cytotoxic cells.
25278023 LFA-1 and CR4 alpha chain phosphorylation is needed for chemokine-induced cross-talk to VLA-4
25251823 overview of the adaptor proteins involved in the intracellular signaling cascades by which LFA-1 regulates T-cell motility and immune responses.
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
25155097 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behcet's disease in Koreans.
25148371 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells
25116953 TLR4-mediated expression of Mac-1 in monocytes plays a pivotal role on monocyte adhesion to vascular endothelium, leading to increased foam cell formation in the development of atherosclerosis.
24995649 Case Report: recurrent pyoderma gangrenosum and cystic acne associated with leucocyte adhesion deficiency due to novel mutations in ITGB2 successfully treated with infliximab/adalimumab.
24945611 Priming by CCL21 restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nanoaggregates on human mature dendritic cells.
24920488 Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner.
24889201 Collectively, beta2 integrin-mediated systemic NET overflow is a novel viral mechanism of immunopathology that may be responsible for characteristic aspects of hantavirus-associated disease such as kidney and lung damage.
24870064 CD18 expression correlated positively with eosinophil numbers in the esophagus of patients with eosinophilic esophagitis.
24829201 circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323.
24703937 IL-32alpha-mediated STAT3 S727 phosphorylation induced C/EBPalpha association, which inhibited PU.1 expression, and then resulted in the down-regulation of CD18 expression.
24500432 Report CR3 expression following resistance exercise.
24276331 shear-induced CD11/CD18 cleavage is phenotypic of neutrophilic cells, including those derived from HL60 cells
24006483 Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells.
23981064 M. tuberculosis-infected DCs exhibit a significant reduction in surface expression of the beta(2) (CD18) integrin.
23960033 In a docking simulation, propofol binds to the lovastatin site in LFA-1.
23921155 First evidence provided of a possible role of ITGB2 in the pathogenesis of biliary atresia
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
23803696 ITGB2 gene polymorphisms are associated with the risk of colorectal neoplasia.
23645883 the capability to produce IL-22 is not restricted to a specific T cell subset, and provide evidence that CR3 might play a significant role in the adaptive host defense against Aspergillus, although the ligand and its action remain to be elucidated.
23595985 the correct functioning of the kindlin 3 PH domain is central to the role that kindlin 3 performs in guiding lymphocyte adhesion and motility behavior, which in turn is required for a successful immune response.
23581432 ICAM-1 and MAC-1 have roles in fibrinogen-inhibited neutrophil adhesion
23532856 EC uptake of soluble MPO, namely the cell contact-dependent, beta2 integrin-mediated transfer from neutrophils. The findings could be of therapeutic relevance in atherosclerosis and vasculitis.
23469114 the 3D structure of the alphaA-containing ectodomain of the leukocyte integrin CD11b/CD18 (alphaMbeta2) in its inactive state
23460610 HPK1 is critically involved in LFA-1-mediated polymorphonuclear neutrophils trafficking during acute inflammation.
23451151 findings demonstrate that the reduction in CR3-mediated phagocytosis associated with the 77H CD11b variant is not macrophage-restricted but demonstrable in other CR3-expressing professional phagocytic cells
23442854 In addition to LFA-1, shear stress is a contributing factor to leukocyte migration directionality.
23388428 Our results suggest that a promoter SNP (rs2070946) of ITGB2 might be associated with a risk of papillary thyroid cancer.
23386618 Complement receptor 3 influences toll-like receptor 7/8-dependent inflammation
23243275 Studies suggest that Am80 promote bactericidal activities probably through coordinating the functional interaction of CD66 with CD18 to enhance the development of neutrophil immunity during granulopoiesis.
23234758 Monodisperse and LPS-free Aggregatibacter actinomycetemcomitans leukotoxin: interactions with human beta2 integrins and erythrocytes.
23210443 AA treatment induced upregulation of LFA-1.
23206327 This study analysis revealed up-regulation of CD14, CD18, CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36, CX3CR1, CX3CL1 and CD200 in postmenopausal women.
23184931 macrophage interleukin-13 receptor has a role in foam cell formation through alphaMbeta2 integrin interference
23180820 A dramatic regulatory input of phosphoinositide 3-OH kinase (PI3K) into the regulation of beta2 integrin activity is exhibited by signaling through PI3K effector ARAP3 via analysis of neutrophils from a point-mutation knock-in mouse.
23144497 Consolidation of leukocyte function antigen (LFA)-1 bond clusters within the plane of adhesion is dependent on application of shear stress and cytoplasmic association of Kindlin-3, but not Talin-1.
23133361 A mathematical model is proposed of CR3/TLR2 signaling in response to F.tularensis, and the model confirms that phagocytosis-associated changes in the cell membrane can inhibit ERK activity and predicts that Akt and Ras-GAP synergize to inhibit ERK.
23097489 Studies indicate that Radil regulates neutrophil adhesion and motility by linking Rap1 to beta2-integrin activation.
23039186 Demonstrated that melanoma cells can cross endothelial monolayers in vitro due to the induction of ICAM-1 and LFA-1 occurring during the co-culture of melanoma and endothelial cells.
23001012 A single domain antibody directed against functional and structural modules of L-plastin reduced the association between LFA-1 and L-plastin, impaired MTOC docking, immune synapse formation and T cell activation.
22933624 Mac-1 regulation of FcgammaRIIA-mediated neutrophil recruitment is identified as a key step in development of target organ (kidney) damage.
22911848 JAB1 expression overcame the inhibition of HIV-1 replication in the presence of peptide and also promoted HIV-1 replication in activated primary CD4(+) T cells through LFA-1.
22908191 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
22893614 CD11b suppressed induction of NFATc1 by the complementary mechanisms of downregulation of RANK expression and induction of recruitment of the transcriptional repressor B-cell lymphoma 6 (BCL6) to the NFATC1 gene.
22888138 CR3 and CR4 (CD11c/CD18) mediate infection of human monocyte-derived macrophages.
22844116 In transgenic mice, integrin alphaXbeta2 is required to control Candida albicans infection; in the brains of mice postinfection, C. albicans forms a visible network of numerous fungal hyphae.
22778269 Thioredoxin reductase linked to cytoskeleton by focal adhesion kinase reverses actin S-nitrosylation and restores neutrophil beta(2) integrin function.
22707713 suggest an important role for LFA-1/ICAM-1 interactions in immunoregulation concurrent with lymphocyte migration that may have implications at the level of local inflammatory response and for anti-LFA-1-based therapies
22697794 The data indicate that the LFA-1/ICAM-1 interaction may limit apoptosis in HIV-1-infected T cells.
22396536 analysis of activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and beta2 integrins
22393018 analysis of complement recognition by integrin alphaXbeta2
22232682 complement receptor 3 is a MyD88-independent phagocytic receptor for Borrelia burgdorferi, and also participates in the modulation of the proinflammatory output of macrophages.
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
22156198 release of hydrogen peroxide the neutrophils into the immunological synapse between neutrophils and T cells mediated the suppression of T cell proliferation and required neutrophil expression of the integrin Mac-1
22134107 In leukocyte adhesion deficiency-I (LAD-I), mutations are found in ITGB2, the gene that encodes the beta subunit of the beta2 integrins. (Review)
22095715 Denticity of the Asp/Glu ligand of integrin CD11b/CD18 can modify divalent cation (calcium or magnesium) selectivity at the metal ion-dependent adhesion site in neutrophils, and hence integrin function.
22083532 High LFA-1 expression is associated with colorectal adenocarcinomas.
22052909 structures and interaction analyses of integrin alphaMbeta2 cytoplasmic tails
22017400 HIV-1 assembles on intracellular plasma membrane-connected compartments (IPMC). CD18 is associated with the IPMC in electron-dense coated domains and is involved in the organization and integrity of these compartments.
22017400 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
21876037 Activation through the T cell receptor results in phosphorylation of LFA-1 that leads to engagement of Tiam1 and Rac1
21874872 The data obtained suggest that spontaneous cell adhesion to fibrinogen is mediated to a greater extent by CD11b/CD18 integrins, while chemokine-stimulated adhesion and migration is mostly dependent on CD11c/CD18 molecules.
21856004 crystallographic data on the structure of CD11c/CD18 and prediction of the secondary structure of the C4BP oligomerization domain, we show that epitopes bound by KIM185 in these proteins are unlikely to share any major structural similarity
21840991 analysis of beta2-integrin and intercellular adhesion molecule 1 binding kinetics in tumor cell adhesion to leukocytes and endothelial cells by a gas-driven micropipette assay
21712539 the cross-talk between neutrophils and NK cells is mediated by ICAM-3 and CD11d/CD18, respectively.
21705617 Galpha(i)-dependent, chemokine-upregulated T cell adhesion is mediated by alphaLbeta2 and alpha4beta1 integrins.
21676865 low density lipoprotein receptor-related protein 1 (LRP1) interacts with integrin alphaMbeta2 at specific binding sites
21651795 Cigarette smoke extract induces a direct transendothelial cell migratory effect on neutrophils via activation of beta2-integrins on the cell surface.
21610569 Data found that blocking CD11b, CD18, or CD54 on the endothelial progenitor cells (EPC) surface with monoclonal antibodies protected EPCs, enhancing its survival.
21605078 These results demonstrate a distinct physiological role for Ser(756) of beta2 integrin, in conjunction with the actions of talin and Rap1, during alphaMbeta2 activation in macrophages.
21597477 Studies indicate that transformation of LFA1 from a bent, resting form to an extended conformation is essential for T cell migration and the formation of an immunological synapse.
21536861 Spreading of activated T-lymphocytes on dendritic cells expressing ICAM-1 involves LFA-1 microclustering within scattered focal dots (presumably at immunological synapses).
21511340 findings suggest that cytohesin-1 is a key regulator of neutrophil adhesion to endothelial cells and to components of extracellular matrix, which may influence cell emigration through its dual opposing effect on beta2 and beta1 integrin activation
21454358 We show that sequential cleavage of C-terminal amino acids from the beta(2) cytoplasmic tail of LFA-1, by cathepsin X, enhances binding of the adaptor protein talin to LFA-1 and triggers formation of the latter's high-affinity form
21297967 significantly decreased expression of CD18 and AKNA suggests a role for both proteins in the pathogenesis of Vogt-Koyanagi-Harada syndrome
21270398 LFA-1 binding to intercellular adhesion molecule-1 (ICAM-1) results in T-cell receptorzeta and Syk kinase phosphorylation.
21269583 Results suggested that CD18 AvaII polymorphism is not associated with Henoch-Schonlein purpura susceptibility and its clinical outcomes.
21244370 LFA-1 plays a key role in regulating neutrophil recruitment, CXCL2 formation and tissue injury in the pancreas. LFA-1-mediated inflammation is a downstream component of trypsinogen activation in the pathophysiology of acute pancreatitis.
21200022 Through its control of high-affinity LFA-1, the LFA-1/Lck/ZAP-70 complex is in position to initiate the rapid adhesion and migration necessary for T-lymphocyte responses when stimulated vasculature is encountered at sites of infection or injury.
21193407 pivotal role of the NB1-Mac-1 receptor interaction for PR3-ANCA-mediated neutrophil activation
21152086 Findings support the idea that calpain is involved in the turnover of LFA-1 adhesions at the rear of the cell.
21135163 Involvement of CD11b/CD18 (Mac-1) in fibrin(ogen)-mediated melanoma-neutrophil aggregations is defined in a study of cell interactions linked to thrombosis, inflammation, and cancer metastasis under venous flow conditions.
21078912 TCR signals fail to trigger LFA-1 headpiece activation unless the integrin first gets stabilized by surface-bound ICAM-1
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21030716 During hypertriglyceridemia, monocytes internalize lipids, upregulate CD11c/CD18, and increase adhesion to VCAM-1.
20953905 LFA-1 gene polymorphisms may predict the sporadic breast IDC risk and prognosis factors in Chinese Han women in Heilongjiang Province
20945386 This dataset expands the list of the signaling components of the LFA-1 induced phosphotyrosine protein complexes in migrating T-cells.
20826754 we show that shedding of human CD11/CD18 complexes is a part of synovial inflammation in rheumatoid arthritis and spondyloarthritis but not in osteoarthritis
20805842 Our data indicate that on DCs LFA-1 may function as an inducible anchor during lymphatic transmigration or within the lymph nodes.
20802378 Observational study of genetic testing. (HuGE Navigator)
20739459 CCL21 stimulates dendritic cell translymphatic migration by a beta2 integrin-mediated mechanism in TNFalpha-stimulated human dermal lymphatic endothelial cells (HDLECs).
20679211 Data revealed that alpha(X)beta(2) in the extended-open headpiece conformation had high affinity for ligand, whereas both the bent conformation and the extended-closed headpiece conformation represented the low affinity state.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20665668 Rap1-mediated activation of alpha(M)beta(2) in macrophages shares both common and distinct features from Rap1 activation of alpha(IIb)beta(3) expressed in CHO cells.
20661303 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618153 LFA-1 expression level on leukemic cell lines suggests the possibility of differential binding of an LFA-1 cyclic peptide that could enable internalization of therapeutic nanoparticles into leukemic cells.
20580686 uPAR acts as a cofactor for iC3b binding to CR3 and regulates CR3-mediated phagocytosis.
20549317 different mutations in ITGB2 gene underlie the development of leukocyte adhesion deficiency type 1.
20529581 a novel point mutation Asp 300 Val located in a highly conserved region (HCR) of CD18 and confirmed the heterogeneity of the mutations causing LAD-1, indicating it was quite beneficial to establish correct and early diagnosis in children with severe LAD-1
20511548 T helper (Th)17 cells adhere to mesenchymal stem cells through the joined involvement of CCR6 and CD11a/CD18 and their respective ligands, leading to induction of a regulatory phenotype in fully polarized tissue-infiltrating Th17 cells.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20445017 Human neutrophil rolling on E- or P-selectin induces the extended alpha(L)beta(2) integrin conformation through signaling triggered by PSGL-1 engagement.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20409465 The impact of inside-out and outside-in signaling in neutrophils on the lifetimes and mechanical strengths of ICAM-1 bonds to beta2 integrin on the cell surface, was examined.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20362473 show that high-avidity ligation of ITAM-coupled beta2 integrins and FcgammaRs in macrophages inhibited type I interferon receptor and Toll-like receptor (TLR) signaling and induced expression of interleukin-10
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233927 ITGB2 plays a key role during C. pneumoniae entry. The combination knockdown of CXCR7, ITGB2, and PDGFB significantly inhibits C. pneumoniae entry.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20130240 Impaired NK-cell migration in WAS/XLT patients: role of Cdc42/WASp pathway in the control of chemokine-induced beta2 integrin high-affinity state
20033057 Structure of an integrin with an alphaI domain, complement receptor type 4.
20008295 Complement receptor 3 (CD11b/CD18; alpha(M)beta2 integrin) was identified as the major cellular receptor on neutrophils for CFH, CFHL1, and CFHR1, but not for CFHR4 long isoform
20007244 The role of beta(2)-integrins in demyelinating disease and new information about the role of beta(2)-integrins with respect to alterations in Treg numbers and function, is summarized.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864611 These data suggest the primacy of global conformational changes in the generation of Mac-1 outside-in signals.
19863185 The CR3(CD11b/CD18) on PMNs was measured in NLF sample via chemiluminescence, and the technique shows promise as a diagnostic method for measuring upper airway LPS exposure.
19821948 A C-to-T SNP at Nt 1949 of exon 2o that predicted a threonine to methionine switch at position 619 was associated with neonatal alloimmune thrombocytopenia.
19800635 The combination of high environmental stress and low CNS serotonin lead to increased expression of the beta(2)-integrins CD11b and CD11c on monocyte cell surfaces.
19750481 Gradual cleavage of LFA-1 by cathepsin X enables the transition between intermediate and high affinity LFA-1
19730683 Observational study of gene-disease association. (HuGE Navigator)
19728062 Binding of integrin beta 2 to angiopoietin-2 eliminates Ang-2/platelet-derived growth factor-BB-mediated upregulation of monocyte fibrin invasion.
19721069 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
19647987 Studies indicate that LAD I is due to the mutations in beta2-integrin essential for firm adhesion.
19617577 Kindlin-3 is more critical to LFA-1 than to VLA-4-adhesive functions in human lymphocytes.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19571252 multiple CD11d domains play a role in controlling intracellular location and association with CD18.
19568411 Caki-1 cell-mediated NK cell apoptosis was reduced by an anti-beta(2)-integrin (CD18) monoclonal antibody
19446361 In Helicobacter pylori infection, cathepsin X mediated activation of beta-2 integrin receptor Mac-1 suppresses the stimulatory signal in the form of cytokines.
19423540 Nine SNPs distributed across eight genetic regions (ALOX5, IRAK3, ITGB2, NCF2, NFKB1, SELP, SOD1, and STAT1) were associated with risk of glioma with P value of <0.01.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19372628 Circulating neutrophils and monocytes of the ragpickers in India overexpressed CD11b/CD18 and their platelets had upregulated surface expression of P-selectin, implying functional activation of these cells
19372141 Observational study of gene-disease association. (HuGE Navigator)
19360456 CD21 is tightly related to LFA-1 expression in B-cell lymphoma (BCL) and the absence of CD21/LFA-1 expression is associated with pleural/peritoneal fluid involvement by BCL
19353432 LFA and VLA-4 were expressed in inflammatory cells in all inflammatory diseases in almost equal numbers
19353220 This study shows that higher neutrophil PSGL-1 expression on admission may imply a higher risk for END and that monocyte Mac-1 expression on admission reflects the severity of ischemic stroke on admission.
19340879 Decreased leukocyte function associated antigen-1 is associated with infliximab therapy.
19307784 CD18 plays a critical role in human monocyte and lymphocyte transendothelial migration across pocine endothelial cells.
19290459 Pretreatment eosinophils with anti-CD18 antibody to block substrate interactions with beta(2)-integrins, abolished the increase in impedance and adherent morphology of the cells. It shows Beta2-integrin mediated adhesion and intracellular Ca2+ release.
19264679 Platelet clearance comprises 1)adhesion to neutrophils and depends on P-selectin, on the PSGL-1, and on the CD11b/CD18 beta2 integrin; and 2)internalization, which is abrogated by the phosphatidylserine-binding protein annexin A5
19261694 in the absence of LFA-1 expression, NK cells are fully capable of recognizing a target (C. neoformans) and retain all of the events required for cytotoxicity.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234188 Functioning across species, human T regulatory cells (Treg) mediate the targeting of mouse dendritic cells via a human LFA-1-mouse ICAM-1-dependent interaction.
19175917 involved in MCP-1 production by monocytes following OK-432 (lyophilized Streptococcus pyogenes) stimulation
19139946 Quantitative assessment of T cell beta2-integrin activation allows to identify high risk patients with unstable angina and without established MI
19136961 chemokines control lymphocyte trafficking by triggering a Rho-dependent signaling cascade leading to conformer-specific modulation of LFA-1 affinity.
19135988 Data confirmed the increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19086264 the role of protein kinase C zeta (PKCzeta) in interleukin (IL)-8-mediated activation of Mac-1 (CD11b/CD18) in human neutrophils
19073595 the heparan sulfate proteoglycan form of epithelial CD44v3 plays a critical role in facilitating PMN recruitment during inflammatory episodes via directly binding to CD11b/CD18.
19056482 Observational study of gene-disease association. (HuGE Navigator)
19052753 Fibfromyalgia patients showed a significantly decreased expression of CD18 on neutrophils.
19029120 These data suggest that disruption of the TM interface changes alphaLbeta2 ligand binding affinity, and it may contribute to alphaL micro-cluster formation
18955128 Data show that the Anger Recall Interview induces a increase in monocyte expression of beta2-integrins.
18941116 either uPA/uPAR interaction, Mac-1 activation, or prevention of its association with uPAR triggers a signaling pathway leading to the inefficient release of HIV from monocytic cells
18922916 Rap1-induced activation of both alpha4beta1 and alphaLbeta2 is defective, autocrine VEGF and chemokine are necessary to activate alpha4beta1 for ligand binding.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18829897 Inhibition of Na+/H+ exchanger enhances low pH-induced L-selectin shedding and beta2-integrin surface expression in human neutrophils.
18820737 SIRPalpha negatively regulates beta(2) integrin-mediated monocyte adhesion, transendothelial migration and phagocytosis
18818407 raised plasma sP-selectin may influence the early progression of vascular disease by promoting leukocyte adhesion to the endothelium in PAOD, through Mac-1-mediated rolling and dependent on endothelial P-selectin expression.
18802065 Circulating blood monocytes attach through the LFA-1 integrin to activated brain microvascular endothelial cells expressing high levels of ICAM-1.
18755982 Class III PI3K Vps34 is responsible for the synthesis of PtdIns(3)P on phagosomes containing either S aureus or E coli. PtdIns(3)P binding to p40(phox) is important for CD18-dependent activation oxidase activation in response to S aureus and E coli
18714035 closely related alpha(M)beta(2) ligands, plasminogen and angiostatin, derived from plasminogen, as well as fibrinogen and its two derivative alpha(M)beta(2) recognition peptides, P1 and P2-C, differed markedly in their effects on neutrophil apoptosis.
18685529 Neutrophil chemotaxis and polarization were found to be impaired 24 h postexercise. Adherence was impaired 24 h postexercise as well, but the expression of the adhesion molecule CD11b/CD18 was not affected
18676132 Down regulation of CD11b and CD18 expression in children with hypercholesterolemia: a preliminary report.
18675632 Impaired CD18 leukocyte regulation can probably linked to genetic ITGB2 predisposition to Hirschsprung associaed enterocolitis.
18675632 Observational study of gene-disease association. (HuGE Navigator)
18644795 analysis of conformational changes in the alpha(M)beta(2) headpiece and reorientation of its transmembrane domains when alpha(M)beta(2) interacts with uPAR
18636124 Observational study of gene-disease association. (HuGE Navigator)
18626404 Erythropoietins down-regulate the expression of ICAM-1 and LFA-1, and through binding to LFA-1, they interfere with ICAM-1/LFA-1 interaction.
18617697 Myeloperoxidase independent of its catalytic activity through signaling via the adhesion molecule CD11b/CD18 rescued human neutrophils from constitutive apoptosis and prolonged their life span.
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18550856 the phosphorylation of beta2 integrins on Thr758 acts as a molecular switch to inhibit filamin binding and allow 14-3-3 protein binding to the integrin cytoplasmic domain, thereby modulating T-cell adhesion
18509085 cooperation of the alpha(M)beta(2)/GPIbalpha and to PSGL-1/P-selectin systems regulates the prothrombotic properties of PMN-derived microparticles and MP-induced platelet activation
18495784 MAC-1 expression in neutrophils is regulated in the first 11 months of life, when it reaches 50 per cent of the adult level.
18414903 Cancer patients with infection had higher blood neutrophil and monocyte CD11b/CD18 expression levels than patients with neoplastic fever, those with advanced cancer without infection, or healthy controls
18397383 These results show that the beta2 integrin CR3 is an important receptor for phagocytosis of Neisseria meningitidis.
18375764 Bordetella pertussis CyaA binding to CD11b/CD18
18369341 The rs235326 polymorphism in the ITGB2 gene is associated with obesity in Japanese living in the United States whose diet has become "westernized."
18369341 Observational study of gene-disease association. (HuGE Navigator)
18367725 beta(2)-integrin adhesion actjvates Pyk2, which is a required signal for eosinophil spreading and subsequent chemotactic migration
18322203 A targeted role is now indicated for integrin alphaMbeta2 in the pathogenesis of demylinating diseases.
18306933 In patients with Dukes stage C/D colorectal cancer, the Cox Proportional Hazard Model analysis demonstrated a significant association between increased patient survival and low expression of ITGB2 (p = 0.011) and NPR1 (p = 0.023) genes.
18279666 we found that as compared with the diffusion in the absence of beta(2) subunit, the diffusion of single-molecule of alpha(M)-YFP was suppressed significantly in the presence of beta(2) subunit.
18199704 Determined kinetic parameters of beta 2-integrin and ICAM-1 bindings bindings between neutrophils and melanoma cells in a shear flow.
18191791 Thus, H. pylori co-opts CD18 as a VacA receptor on human T lymphocytes to subvert the host immune response.
18174366 Proinflammatory effects of VIP are associated with stimulation of exocytosis of secretory vesicles as well as tertiary (gelatinase) granules with, respectively, up-regulation of the membrane expression of the beta2 integrin.
18164590 TNF-alpha unveils a previously unknown capacity of neutrophils to migrate to CCL3 through the intervention of Mac-1.
18076013 The multimarker phenotype of the absence of CD8+ TILs, loss of p27, and positive uPA expression was predictive of an adverse prognosis in patients with lymph node-negative, MMR-proficient colorectal cancer.
18065787 HD patients with a low P(HCO3) exhibited low neutrophil pHi that in turn increased the expression of CD11b/CD18. This increased expression of CD11b/CD18 on the uraemic neutrophils may contribute to the pHi-mediated phagocytosis.
18057877 Observational study of gene-disease association. (HuGE Navigator)
18032709 These data demonstrate that activation of Epac1 increases integrin activity and integrin-dependent homing functions of progenitor cells.
17996943 triggering CD43 and the underlying signaling pathways enhance LFA-1 adhesiveness while CD43 also negatively regulates LFA-1 induction via other receptors by dynamic interaction with either LFA-1 or CD147.
17900957 These results indicate that beta 2-integrin and PI-3-kinase are crucial signaling molecules in reactive oxygen species-dependent apoptosis of neutrophils induced by E. histolytica.
17875809 The discovery of 3 cases of reversion mutations in LAD-1 at one center suggests that this may be a relatively common event in this rare disease
17726152 The results from this study present TANGO as a novel ligand for CD11c, regulating migratory processes of hematopoietic cells.
17721605 review focuses on the non-receptor tyrosine kinase Syk as an important downstream signaling component of beta2 integrins (CD11/CD18) that is required for the control of different PMN functions including adhesion, migration and phagocytosis.
17719638 the compartmentalization of HLA-DR/CD18 complex within or outside lipid rafts as a mechanism through which HLA-DR can integrate both PTK and PKCbeta signals leading to activation and death
17716608 Plasma from septic patients led to a constantly increased expression of beta(2)-integrins on isolated, unstimulated neutrophils.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17676580 Fluid shear-induced activation and cleavage of CD18 during pseudopod retraction by human neutrophils.
17673459 analysis of the leukocyte beta2 integrins and interpretation of the transition between the resting and active states of leukocyte function-associated antigen-1
17644514 Beta2-integrins and acquired glycoprotein IIb/IIIa (GPIIb/IIIa) receptors cooperate in NF-kappaB activation of human neutrophils
17635865 Study demonstrates that the human CD18 is the receptor for Aggregatibacter actinomycetemcomitans leukotoxin.
17591777 talin induced an intermediate affinity alphaLbeta2 that adhered constitutively to its ligand intercellular adhesion molecule ICAM-1 but not ICAM-3.
17531998 Patients with primary hypertriglyceridemia as compared with control subjects showed significant increases in monocyte CD18 (cell adhesion molecule 18) and Lymphocyte CD18
17522381 Results identify two novel lipopolysaccharide (LPS)-binding sites located at the CD18 betaA domain of leukocyte integrin, and the integrin peptide betaA(266-318) is shown to inhibit LPS binding and subsequent inflammatory events.
17468108 integrins alphaLbeta2 and alphaIIbbeta3 are activated by mutation of a conserved asparagine in the I-like domain
17346796 PLD-synthesised PtdOH stimulates the generation of PtdIns(4,5)P(2), which in turn mediates talin binding to, and activation of, CD11b/CD18 required for neutrophil stable adhesion and migration.
17311314 IL4-induced FBGC are characterized by the expression of alphaMbeta2, alphaXbeta2, alpha5beta1, alphaVbeta1, alpha2beta1, and alpha3beta1, which indicates potential interactions with fragments of C3, fibrin(ogen), fibronectin, Factor X, and vitronectin
17222807 In contrast, neutrophil adhesion to fibronectin was completely inhibited by anti-beta2 integrins, suggesting that S100A9-induced specific activation of beta2 integrin is essential to neutrophil adhesion.
17107954 phosphorylation of Thr-758 in beta2 as a proximal element in LFA-1 signaling
17016617 Observational study of gene-disease association. (HuGE Navigator)
16963453 study that demonstrated the engagement of beta2 integrins on human neutrophils increased the levels of GTP-bound Rap1 and Rap2 is presented.
16915040 telmisartan inhibits the expression of the pro-inflammatory beta2-integrin MAC-1 expression in lymphocytes independently of angiotensin II
16901728 results suggest that current models of LFA-1 regulation are incomplete and that LFA-1 confinement by cytoskeletal attachment regulates cell adhesion both negatively and positively
16846215 Mac-1 binding confers FcgammaRIIA with the ability to prolong cell adhesion as well as to spread and migrate on the ICs, leading to effective cell killing by antibody dependent cell cytotoxicity.
16782049 Mac-1 subunits take different conformation when expressed in Chinese hamster ovary (CHO) and human embryonic kidney (HEK) 293T cells, respectively
16774752 Active cathepsin X mediates the function of beta(2) integrin receptors during cell adhesion and that it could also be involved in other processes associated with beta(2) integrin receptors such as phagocytosis and T cell activation.
16764927 Clinical usefulness of a panel of beta2 integrins in accurate prediction of acute promyelocytic leukemia and recommendation of inclusion to identify patients who require retinoic acid therapy.
16506060 Analysis of lymphocyte subsets showed that the total number of CD3+, CD4+, CD8+ and CD56+ lymphocytes increased after the intensive protocol before falling below pre-exercise values at 1 h post-exercise.
16505487 the integrin alphaLbeta2 intermediate affinity state has a role in transition from rolling to firm adhesion
16492228 Down-regulation of LFA-1 expression by lymphocytes could antagonize their transvascular migration, supporting the hypothesis of sterile inflammation in the dura mater during migraine attacks.
16467205 in hematopoietic cells stimulated via CXCR4, Lyn kinase is a positive regulator of cell movement while negatively regulating adhesion to stromal cells by inhibiting the ICAM-1-binding activity of beta(2) integrins
16415171 platelets, by binding via P-selectin to PSGL-1 on monocytes, induce up-regulation and activation of beta1 and beta2integrins and increased adhesion of monocytes to activated endothelium.
16403785 data demonstrate that Lp(a), via its apo(a) moiety, is a ligand for the beta2-integrin Mac-1, thereby facilitating inflammatory cell recruitment to atherosclerotic plaques; these observations suggest a novel mechanism for atherogenic properties of Lp(a)
16239529 studies suggest that the activation and surface expression of CR3, FHA expression, and the efficiency of ACT internalization all influence whether B. pertussis will be phagocytosed and ultimately killed by neutrophils
16037628 In DVT subjects, at baseline, the phenotypical expression of CD11b was decreased and that of CD11c was increased, and upon PMN activation in DVT subjects CD11b, CD11c and CD18 increased, while CD11a expression did not show any change
15965234 x-ray crystallographic structure of the plexin-semaphorin-integrin domain/hybrid domain/I-EGF1 segment of integrin beta 2
15958383 the hybrid domain of integrin alphaL beta2 has different requirements of affinity states for ICAM-1 and ICAM-3 binding
15802551 extracellular signal-regulated kinase-mediated adhesion of beta(2)-integrin caused by IL-5 is mediated in human eosinophils by a class IA PI3K through activation of a PKCdelta pathway
15741160 Phagocytosis of chilled platelets by macrophages is mediated by integrin beta 2 subunit.
15665082 adhesion of human neutrophil granulocytes to fibrinogen is greatly increased by plasmin digestion in a mode where alphaXbeta2 dominates the integrin-dependent binding
15641787 A novel binding region within the central domain of the fibrinogen gamma-module localizes within gamma residues 228-253 and has been identified as the integrin beta 2 subunit of Mac-1.
15615722 the beta2I domain of integrin alphaMbeta2 has a site which supports ICAM-1 binding to alpha(M)beta(2) and controls the open and closed conformation of the alpha(M)beta(2) receptor
15558232 Monocytic CD18 was elevated both in the diabetes and in the impaired glucose tolerance.
15485828 each subunit of alphaMbeta2 contributes distinct properties to alphaMbeta2 and that, in most but not all cases, the response of the integrin is a composite of the functions of its individual subunits
15454120 we have shown here that eosinophils from atopic children expess Mac-1 and demonstrated that this expresion may be upregulated by fMLP.
15328156 the absence of low-density lipoprotein receptor-related protein resulted in complete abrogation of beta2-integrin-dependent adhesion to endothelial cells in a perfusion system
15304494 studies of the interaction of the ligand binding alphaMI-domain of alphaMbeta2 with the D fragment of fibrinogen, which has multiple binding sites for integrin alphaMbeta2
15294914 BAP31 may play a role in regulating intracellular trafficking of CD11b/CD18 in neutrophils
15258348 No conclusive differences in neutrophil levels in vascular atherosclerotic disease and in type 2 diabetes mellitus.
15241561 HGF and IL-1ra adhesion-dependent release from human blood granulocytes and monocytes involves plasma IgG, complement C3 and beta2 integrin
15235127 hypoxia induces leukocyte beta2 integrin expression and function by transcriptional mechanisms dependent upon HIF-1.
15187162 Binding of E-selectin signaled activation of beta(2)-integrin to high-avidity clusters and elicited efficient neutrophil capture of beta(2)-integrin ligands in shear flow
15181567 plays an important role in lymphocyte trafficking to CSF during HIV-1 infection. .
15090462 findings identify Glu-Pg as an adhesive ligand for integrins alphaMbeta2 and alpha5beta1 and suggest that alpha5beta1 may participate in the binding of soluble Glu-Pg and assist in its activation
14769799 assembly of Plg and uPA on integrin alpha(M)beta(2) regulates Plm activity and, thereby, plays a crucial role in neutrophil-mediated thrombolysis
14748512 some of the GPI-80 on pseudopodia of migrating neutrophils during the late phase was associated with urokinase-type plasminogen activator receptor (uPAR), a regulator of beta2 integrin-dependent adherence and migration
14702343 activation by T cell antigen receptor depends on rap1 and phospholipase C-gamma1
14676297 CD226 is involved in LFA-1-mediated costimulatory signals for triggering naive T cell differentiation and proliferation.
14576361 IkappaBalpha was markedly degraded at 1 h, and NF-kappaB-DNA-binding activity markedly increased 2 h after beta(2) integrin aggregation, which activated IkappaB kinase activity at 1 h.
14512306 Two novel CD18 mutations were identified in a patient who was a compound heterozygote with type 1 leukocyte adhesion deficiency and whose phenotype was typical except that he exhibited hypertrophic scarring.
13679375 role in inhibiting Fas-mediated apoptosis in T-lymphocytes
12960243 Interaction of proteinase 3 with CD11b/CD18 (beta2 integrin) on the cell membrane of human neutrophils.
12952972 Mac-1 and glycoprotein Ib bind in an interaction mediated by high molecular weight kininogen
12885870 Data show that engagement of the beta2 integrin LFA-1 on NK cells by intercellular adhesion molecule (ICAM)-1 led to phosphorylation of Vav1 that was not sensitive to cholesterol depletion or inhibition of actin polymerization.
12847278 The extracellular, membrane-proximal region of the CD18 subunit plays an important role in integrin activation and therefore could be targeted by certain cell surface proteins as a conduit to control the integrin "inside-out" signaling process.
12824186 integrin beta 2 has a role in cell migraion through binding to progelatinase
12816955 C3bi binds to integrin alpha M beta 2
12771186 beta2 integrin (CR3)-mediated phagocytosis and oxidation is triggered by calcium signals
12760968 Our results indicate that induction of Ca2+ entry by the depletion of Ca2+ from intracellular stores upregulates CD11b/CD18 expression on eosinophils and primes eosinophil transmigration across lung epithelium.
12731070 Fibrinogen-CD11b/CD18 interaction activates the NF-kappa B pathway and delays apoptosis in human neutrophils.
12694184 ICAM-4 binds to the I domain of this integrin.
12682249 The phosphorylation of beta 2 integrin occurs on the first threonine of the threonine triplet in okadaic acid-pretreated CD3 stimulated T cells.
12676940 beta2 integrins induced stimulation of Cdc42 that was independent of Src family members and mediated decrease in GTP-bound Rac1 and Rac2
12643440 Strongly expressed in histological type II of rheumatoid arthritis.
12617168 review of activation pathways for ITGB2 and other leukocyte adhesion molecules
12600815 the expression of ICAM-1 might involve both p38 MAPK and NF-kappaB activities, whereas the regulation of CD11b, CD18, and ICAM-3 expressions might be mediated through p38 MAPK but not NF-kappaB.
12576754 Level of expression of the adhesion molecule/complement receptor CD11b/CD18 and the chemokine receptor IL-8 receptor-A was also higher after vaginal delivery.
12529399 R-Ras promotes focal adhesion formation by signaling to FAK and p130(Cas) through a novel mechanism that differs from but synergizes with the alpha2beta1 integrin.
12516552 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12444150 Function of the lectin domain of Mac-1/complement receptor type 3 (CD11b/CD18) in regulating neutrophil adhesion.
12393547 recognition of uPA by alpha(M)beta(2) allows for formation of a multicontact trimolecular complex, in which a single uPA ligand may bind to both uPAR and alpha(M)beta(2); interaction of uPA with each receptor influences cell adhesion and migration
12390020 The mechanism that regulates the unmasking of the integrin beta 2 cryptic binding site in the gamma C-domain of fibrinogen has been identified.
12379807 Data suggest that calcium activation of calpain causes beta2 integrin liberation, and that this signal plays a key role in the acceleration of beta2 integrin-mediated phagocytosis.
12377941 TNF-induced respiratory burst by polymorphonuclear leukocytes residing on fibronectin is mediated by alpha(L)beta(2)
12377937 iIgA promotes neutrophil apoptosis through a mechanism dependent on CD18 cooperation, which involves the activation of the respiratory burst
12377933 CD18 plays a role in the migration of interstitial dendritic cells in vivo
12377763 investigation of molecular basis for broad ligand recognition
12368274 Transition from rolling to firm adhesion is regulated by the conformation of the I domain
12324470 identification of functional segments within the beta2I-domain
12244179 Mac-1 (CD18) plays an essential role in establishing SIgA-Fc alpha RI interactions and subsequent neutrophil activation.
12207338 Porphyromonas gingivalis fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12200369 a modest increase in ischemic time results in conversion from a CD18-dependent to a CD18-independent muscle ischemia-reperfusion injury
12183834 Decreased stroma adhesion capacity of CD34+ progenitor cells from mobilized peripheral blood is not lineage- or stage-specific and is associated with low beta 1 and beta 2 integrin expression.
12171996 role of Rap1 GTPase for Mn(2+)- and antibody-induced VLA-4-mediated cell adhesion [VLA-4]
12163503 LFA-1 integrin activation by chemokines requires cholesterol
12145463 Increased expression of CD11b/CD18 adhesion molecules was obtained in PV and ET patients, which could be associated with increased leukocyte adehesiveness contributing to the hypercoagulable state.
12139949 There was a trend toward increased expression of CD18 in Crohn's disease
12097820 ICAM-1/beta2 integrin(CD18 antigen) interactions mediate monocyte adhesion to human saphenous vein
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12055249 The active form of LFA-1 regulates its own function on primary T cells by directing the remodeling of the F-actin cytoskeleton to strengthen T cell adhesion to ICAM-1.
12050191 beta2 integrin avidity in neutrophils regulated by protein kinase A
11986332 novel role for beta1 integrin in regulating fibroblast viability through a PI3K/Akt/protein kinase B signaling pathway in response to a matrix-derived mechanical stimulus
11953106 CD18 may play an important role in pathogenic process(in COPD)
11935032 Observational study of gene-disease association. (HuGE Navigator)
11935032 No association between the CD14 C(-260)T and CD18 codon 441 gene polymorphisms and the incidence of stroke was found in a large, prospective, matched case-control sample from the Physicians' Health Study.
11931654 beta1 and beta2 integrins activate different signalling pathways in monocytes.
11914080 role of the specificity-determining loop of the integrin beta subunit I-like domain in autonomous expression, association with the alpha subunit, and ligand binding
11896403 NMR structure: Cysteine-rich module structure reveals a fulcrum for integrin rearrangement upon activation
11882363 identification of mutations in CD18 from genomic DNA from patients with leukocyte adhesion deficiency
11838958 Down-regulation of cell adhesion molecules LFA-1 and ICAM-1 after in vitro treatment with the anti-TNF-alpha agent thalidomide.
11831866 mutations and polymorphisms in leukocyte adhesion deficiency [review]
11781316 Small molecule inhibitors induce conformational changes in the I domain and the I-like domain of LFA-1
11753075 role in Leukocyte adhesion deficiency syndromes
11751951 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
11714770 Studies of CD18 activation epitopes show that stimulation of T lymphocytes appears to be accompanied by a conformational change in a subpopulation of LFA-1 that does not require ligand binding.
11703955 Observational study of gene-disease association. (HuGE Navigator)
11477072 determined the spatial relationship and functional properties of the integrin beta(2) NTR and mid-region
8757599 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
8568270 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
8558011 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages
1967280 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, beta 2 (ITGB2, complement component 3 receptor 3 and 4) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM      1 - 70
RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML     71 - 140
DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL    141 - 210
TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT    211 - 280
PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS    281 - 350
NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC    351 - 420
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS    421 - 490
QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG    491 - 560
KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE    561 - 630
CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN    631 - 700
IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES     701 - 769
//

Text Mined References (429)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26936951 2016 Leukocyte integrin ?L?2 headpiece structures: The ?I domain, the pocket for the internal ligand, and concerted movements of its loops.
26889827 2016 Proteome Based Construction of the Lymphocyte Function-Associated Antigen 1 (LFA-1) Interactome in Human Dendritic Cells.
26849368 2016 Changes in Soluble CD18 in Murine Autoimmune Arthritis and Rheumatoid Arthritis Reflect Disease Establishment and Treatment Response.
26639818 2016 Mutation spectra of the ITGB2 gene in Iranian families with leukocyte adhesion deficiency type 1.
26563750 2016 Heterogeneity of the Mac-1 expression on peripheral blood neutrophils in patients with different types of epithelial ovarian cancer.
26498406 2016 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration.
26497373 2015 Investigation of ITGB2 gene in 12 new cases of leukocyte adhesion deficiency-type I revealed four novel mutations from Iran.
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
26293614 2015 Contact activation of C3 enables tethering between activated platelets and polymorphonuclear leukocytes via CD11b/CD18.
26283883 2015 Increased Expressions of Integrin Subunit ?1, ?2 and ?3 in Patients with Acute Infection.
26231039 2015 Contact-dependent carcinoma aggregate dispersion by M2a macrophages via ICAM-1 and ?2 integrin interactions.
26216891 2015 IL-18 Is Involved in Eosinophil-Mediated Tumoricidal Activity against a Colon Carcinoma Cell Line by Upregulating LFA-1 and ICAM-1.
26188538 2015 Kindlin 3 (FERMT3) is associated with unstable atherosclerotic plaques, anti-inflammatory type II macrophages and upregulation of beta-2 integrins in all major arterial beds.
26143530 2015 Integrin LFA-1 regulates cell adhesion via transient clutch formation.
26108885 2015 An Alternative Phosphorylation Switch in Integrin??2 (CD18) Tail for Dok1 Binding.
26003300 2015 Different states of integrin LFA-1 aggregation are controlled through its association with tetraspanin CD9.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884075 2014 [The level of expression of molecules of adhesion on monocytes depending on morphological differentiation of nuclei].
25850729 2015 LFA-1-targeting Leukotoxin (LtxA; Leukothera®) causes lymphoma tumor regression in a humanized mouse model and requires caspase-8 and Fas to kill malignant lymphocytes.
25825444 2015 Coordinated expression of DNAM-1 and LFA-1 in educated NK cells.
25703682 2015 Molecular characterization of leukocyte adhesion deficiency-I in Indian patients: identification of 9 novel mutations.
25684021 2015 Interleukin-15-activated natural killer cells kill autologous osteoclasts via LFA-1, DNAM-1 and TRAIL, and inhibit osteoclast-mediated bone erosion in vitro.
25678252 2015 Blocking of LFA-1 enhances expansion of Th17 cells induced by human CD14(+) CD16(++) nonclassical monocytes.
25666810 2015 F-actin flow drives affinity maturation and spatial organization of LFA-1 at the immunological synapse.
25640842 2015 The integrin ?L leg region controls the Mg/EGTA mediated activation of LFA-1.
25624455 2015 Protein tyrosine phosphatase receptor type ? is a JAK phosphatase and negatively regulates leukocyte integrin activation.
25613106 2015 Ligand recognition specificity of leukocyte integrin ?M?2 (Mac-1, CD11b/CD18) and its functional consequences.
25554420 2015 Interaction of Bordetella adenylate cyclase toxin with complement receptor 3 involves multivalent glycan binding.
25514840 2015 Characterization of single amino acid substitutions in the ?2 integrin subunit of patients with leukocyte adhesion deficiency (LAD)-1.
25461401 2015 An anti-inflammatory property of Candida albicans ?-glucan: Induction of high levels of interleukin-1 receptor antagonist via a Dectin-1/CR3 independent mechanism.
25416956 2014 A proteome-scale map of the human interactome network.
25365491 2014 Role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli.
25341726 2015 Expression and targeting of lymphocyte function-associated antigen 1 (LFA-1) on white blood cells for treatment of allergic asthma.
25292215 2014 A signaling network stimulated by ?2 integrin promotes the polarization of lytic granules in cytotoxic cells.
25278023 2014 Specific phosphorylations transmit signals from leukocyte ?2 to ?1 integrins and regulate adhesion.
25251823 2014 Adaptor regulation of LFA-1 signaling in T lymphocyte migration: Potential druggable targets for immunotherapies?
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
25155097 2014 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behçet's disease in Koreans.
25148371 2014 TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells.
25116953 2014 TLR4-mediated expression of Mac-1 in monocytes plays a pivotal role in monocyte adhesion to vascular endothelium.
24995649 2015 Recurrent pyoderma gangrenosum and cystic acne associated with leucocyte adhesion deficiency due to novel mutations in ITGB2: successful treatment with infliximab and adalimumab.
24945611 2014 Priming by chemokines restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nano-aggregates on human mature dendritic cells.
24920488 2014 CD7 promotes extramedullary involvement of the B-cell acute lymphoblastic leukemia line Tanoue by enhancing integrin ?2-dependent cell adhesiveness.
24889201 2014 ?2 integrin mediates hantavirus-induced release of neutrophil extracellular traps.
24870064 2014 Topical corticosteroids do not revert the activated phenotype of eosinophils in eosinophilic esophagitis but decrease surface levels of CD18 resulting in diminished adherence to ICAM-1, ICAM-2, and endothelial cells.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24703937 2014 IL-32? down-regulates ?2 integrin (CD18) expression by suppressing PU.1 expression in myeloid cells.
24500432 2014 Effects of ?-hydroxy-?-methylbutyrate free acid and cold water immersion on expression of CR3 and MIP-1? following resistance exercise.
24276331 2014 Characterization of the shear stress regulation of CD18 surface expression by HL60-derived neutrophil-like cells.
24006483 2013 CD47 plays a critical role in T-cell recruitment by regulation of LFA-1 and VLA-4 integrin adhesive functions.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23960033 2013 Propofol shares the binding site with isoflurane and sevoflurane on leukocyte function-associated antigen-1.
23921155 2013 Polymorphism of ITGB2 gene 3'-UTR+145C/A is associated with biliary atresia.
23803696 2013 Innate immunity gene polymorphisms and the risk of colorectal neoplasia.
23775590 2013 Novel role of ICAM3 and LFA-1 in the clearance of apoptotic neutrophils by human macrophages.
23645883 2013 Aspergillus fumigatus-induced IL-22 is not restricted to a specific Th cell subset and is dependent on complement receptor 3.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
23595985 2013 The kindlin 3 pleckstrin homology domain has an essential role in lymphocyte function-associated antigen 1 (LFA-1) integrin-mediated B cell adhesion and migration.
23581432 2013 Acute-phase concentrations of soluble fibrinogen inhibit neutrophil adhesion under flow conditions in vitro through interactions with ICAM-1 and MAC-1 (CD11b/CD18).
23532856 2013 ?2 integrin-mediated cell-cell contact transfers active myeloperoxidase from neutrophils to endothelial cells.
23469114 2013 EM structure of the ectodomain of integrin CD11b/CD18 and localization of its ligand-binding site relative to the plasma membrane.
23460610 2013 Hematopoietic progenitor kinase 1 (HPK1) is required for LFA-1-mediated neutrophil recruitment during the acute inflammatory response.
23451151 2013 Phagocytosis is the main CR3-mediated function affected by the lupus-associated variant of CD11b in human myeloid cells.
23442854 2013 T lymphocytes orient against the direction of fluid flow during LFA-1-mediated migration.
23388428 2013 Association study of integrins beta 1 and beta 2 gene polymorphism and papillary thyroid cancer.
23386618 2013 Complement receptor 3 influences toll-like receptor 7/8-dependent inflammation: implications for autoimmune diseases characterized by antibody reactivity to ribonucleoproteins.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23243275 2013 Retinoid agonist Am80-enhanced neutrophil bactericidal activity arising from granulopoiesis in vitro and in a neutropenic mouse model.
23234758 2013 Monodisperse and LPS-free Aggregatibacter actinomycetemcomitans leukotoxin: interactions with human ?2 integrins and erythrocytes.
23210443 2012 Hyperketonemia induces upregulation of LFA-1 in monocytes, which is mediated by ROS and P38 MAPK activation.
23206327 2012 Menopause leads to elevated expression of macrophage-associated genes in the aging frontal cortex: rat and human studies identify strikingly similar changes.
23184931 2013 From macrophage interleukin-13 receptor to foam cell formation: mechanisms for ?M?2 integrin interference.
23180820 2013 Phosphoinositide 3-OH kinase regulates integrin-dependent processes in neutrophils by signaling through its effector ARAP3.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23144497 2012 Leukocyte function antigen-1, kindlin-3, and calcium flux orchestrate neutrophil recruitment during inflammation.
23133361 2012 A mathematical model of CR3/TLR2 crosstalk in the context of Francisella tularensis infection.
23097489 2012 Radil controls neutrophil adhesion and motility through ?2-integrin activation.
23039186 2012 LFA-1 and ICAM-1 expression induced during melanoma-endothelial cell co-culture favors the transendothelial migration of melanoma cell lines in vitro.
23001012 2013 Nanobody-induced perturbation of LFA-1/L-plastin phosphorylation impairs MTOC docking, immune synapse formation and T cell activation.
22933624 2012 Human lupus serum induces neutrophil-mediated organ damage in mice that is enabled by Mac-1 deficiency.
22911848 2012 COP9 signalosome component JAB1/CSN5 is necessary for T cell signaling through LFA-1 and HIV-1 replication.
22893614 2013 Negative regulation of osteoclast precursor differentiation by CD11b and ?2 integrin-B-cell lymphoma 6 signaling.
22888138 2012 Natural IgM mediates complement-dependent uptake of Francisella tularensis by human neutrophils via complement receptors 1 and 3 in nonimmune serum.
22844116 2012 Integrin ?X?? is a leukocyte receptor for Candida albicans and is essential for protection against fungal infections.
22778269 2012 Thioredoxin reductase linked to cytoskeleton by focal adhesion kinase reverses actin S-nitrosylation and restores neutrophil ?(2) integrin function.
22707713 2012 Leukocyte function-associated antigen-1/intercellular adhesion molecule-1 interaction induces a novel genetic signature resulting in T-cells refractory to transforming growth factor-? signaling.
22697794 2013 Antibody against integrin lymphocyte function-associated antigen 1 inhibits HIV type 1 infection in primary cells through caspase-8-mediated apoptosis.
22396536 2012 Activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and ?2 integrins.
22393018 2012 Molecular basis for complement recognition by integrin ?X?2.
22232682 2012 CD14 cooperates with complement receptor 3 to mediate MyD88-independent phagocytosis of Borrelia burgdorferi.
22156198 2012 A subset of neutrophils in human systemic inflammation inhibits T cell responses through Mac-1.
22134107 2012 Hematologically important mutations: leukocyte adhesion deficiency (first update).
22095715 2011 Stable coordination of the inhibitory Ca2+ ion at the metal ion-dependent adhesion site in integrin CD11b/CD18 by an antibody-derived ligand aspartate: implications for integrin regulation and structure-based drug design.
22083532 2012 LFA-1 expression in a series of colorectal adenocarcinomas.
22052909 2011 Structures and interaction analyses of integrin ?M?2 cytoplasmic tails.
22017400 2012 ?2 integrin adhesion complexes maintain the integrity of HIV-1 assembly compartments in primary macrophages.
21876037 2011 TCR-induced activation of LFA-1 involves signaling through Tiam1.
21874872 2011 [Participation of beta2-integrins CD11b/CD18 and CD11c/CD18 in adhesion and migration of cells on fibrinogen].
21856004 2011 The role of higher-order protein structure in supporting binding by heteroclitic monoclonal antibodies: the monoclonal antibody KIM185 to CD18 also binds C4-binding protein.
21840991 2011 Determining beta2-integrin and intercellular adhesion molecule 1 binding kinetics in tumor cell adhesion to leukocytes and endothelial cells by a gas-driven micropipette assay.
21712539 2011 On the potential involvement of CD11d in co-stimulating the production of interferon-? by natural killer cells upon interaction with neutrophils via intercellular adhesion molecule-3.
21705617 2011 RGS10 restricts upregulation by chemokines of T cell adhesion mediated by ?4?1 and ?L?2 integrins.
21676865 2011 Molecular basis for the interaction of low density lipoprotein receptor-related protein 1 (LRP1) with integrin alphaMbeta2: identification of binding sites within alphaMbeta2 for LRP1.
21651795 2011 Cigarette smoke induces ?2-integrin-dependent neutrophil migration across human endothelium.
21610569 2011 Trauma-activated polymorphonucleated leukocytes damage endothelial progenitor cells: probable role of CD11b/CD18-CD54 interaction and release of reactive oxygen species.
21605078 2011 Ser756 of ?2 integrin controls Rap1 activity during inside-out activation of ?M?2.
21597477 2011 The insider's guide to leukocyte integrin signalling and function.
21536861 2011 Kindlin-3 is required for the stabilization of TCR-stimulated LFA-1:ICAM-1 bonds critical for lymphocyte arrest and spreading on dendritic cells.
21511340 2011 Cytohesin-1 regulates human blood neutrophil adhesion to endothelial cells through ?2 integrin activation.
21454358 2011 Cathepsin X cleavage of the beta2 integrin regulates talin-binding and LFA-1 affinity in T cells.
21297967 2011 Label-free proteomics reveals decreased expression of CD18 and AKNA in peripheral CD4+ T cells from patients with Vogt-Koyanagi-Harada syndrome.
21270398 2011 ?2 integrin induces TCR?-Syk-phospholipase C-? phosphorylation and paxillin-dependent granule polarization in human NK cells.
21269583 The CD18 AvaII polymorphic site not associated with Henoch-Schönlein purpura.
21244370 2011 Lymphocyte function antigen-1 regulates neutrophil recruitment and tissue damage in acute pancreatitis.
21200022 2011 The integrin LFA-1 signals through ZAP-70 to regulate expression of high-affinity LFA-1 on T lymphocytes.
21193407 2011 Complement receptor Mac-1 is an adaptor for NB1 (CD177)-mediated PR3-ANCA neutrophil activation.
21152086 2010 Calpain 2 controls turnover of LFA-1 adhesions on migrating T lymphocytes.
21135163 2011 Sequential binding of ?V?3 and ICAM-1 determines fibrin-mediated melanoma capture and stable adhesion to CD11b/CD18 on neutrophils.
21078912 2010 Occupancy of lymphocyte LFA-1 by surface-immobilized ICAM-1 is critical for TCR- but not for chemokine-triggered LFA-1 conversion to an open headpiece high-affinity state.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
21030716 2011 CD11c/CD18 expression is upregulated on blood monocytes during hypertriglyceridemia and enhances adhesion to vascular cell adhesion molecule-1.
20953905 2011 LFA-1 gene polymorphisms are associated with the sporadic infiltrative duct breast carcinoma in Chinese Han women of Heilongjiang Province.
20945386 2011 Analysis of dynamic tyrosine phosphoproteome in LFA-1 triggered migrating T-cells.
20826754 2010 Shedding of large functionally active CD11/CD18 Integrin complexes from leukocyte membranes during synovial inflammation distinguishes three types of arthritis through differential epitope exposure.
20805842 2011 The lymphoid chemokine CCL21 triggers LFA-1 adhesive properties on human dendritic cells.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20739459 2010 Inflammation-induced secretion of CCL21 in lymphatic endothelium is a key regulator of integrin-mediated dendritic cell transmigration.
20679211 2010 Requirement of open headpiece conformation for activation of leukocyte integrin alphaXbeta2.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20665668 2010 Rap1 controls activation of the ?(M)?(2) integrin in a talin-dependent manner.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618153 2010 LFA-1 on leukemic cells as a target for therapy or drug delivery.
20580686 2010 Urokinase receptor (uPAR) regulates complement receptor 3 (CR3)-mediated neutrophil phagocytosis.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20549317 2010 Characterization of 11 new cases of leukocyte adhesion deficiency type 1 with seven novel mutations in the ITGB2 gene.
20529581 2010 A novel point mutation in CD18 causing leukocyte adhesion deficiency in a Chinese patient.
20511548 2010 Mesenchymal stem cells inhibit human Th17 cell differentiation and function and induce a T regulatory cell phenotype.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20445017 2010 Rolling on E- or P-selectin induces the extended but not high-affinity conformation of LFA-1 in neutrophils.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20409465 2010 Long-lived, high-strength states of ICAM-1 bonds to beta2 integrin, II: lifetimes of LFA-1 bonds under force in leukocyte signaling.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20362473 2010 Indirect inhibition of Toll-like receptor and type I interferon responses by ITAM-coupled receptors and integrins.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233927 2010 A systemic network for Chlamydia pneumoniae entry into human cells.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20130240 2010 Impaired NK-cell migration in WAS/XLT patients: role of Cdc42/WASp pathway in the control of chemokine-induced beta2 integrin high-affinity state.
20033057 2010 Structure of an integrin with an alphaI domain, complement receptor type 4.
20008295 2010 Factor H and factor H-related protein 1 bind to human neutrophils via complement receptor 3, mediate attachment to Candida albicans, and enhance neutrophil antimicrobial activity.
20007244 2010 beta2-integrins in demyelinating disease: not adhering to the paradigm.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864611 2009 Outside-in signal transmission by conformational changes in integrin Mac-1.
19863185 2009 CR3 (CD11b/CD18) activation of nasal neutrophils: a measure of upper airway endotoxin exposure.
19828450 2009 Identification and characterization of multiple similar ligand-binding repeats in filamin: implication on filamin-mediated receptor clustering and cross-talk.
19821948 2010 New low-frequency platelet glycoprotein polymorphisms associated with neonatal alloimmune thrombocytopenia.
19800635 2010 Socioeconomic status moderates associations between CNS serotonin and expression of beta2-integrins CD11b and CD11c.
19750481 2009 Cathepsin X cleaves the beta2 cytoplasmic tail of LFA-1 inducing the intermediate affinity form of LFA-1 and alpha-actinin-1 binding.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19728062 2009 Association of Ang-2 with integrin beta 2 controls Ang-2/PDGF-BB-dependent upregulation of human peripheral blood monocyte fibrinolysis.
19647987 2009 Genetic etiologies of leukocyte adhesion defects.
19617577 2009 Loss of Kindlin-3 in LAD-III eliminates LFA-1 but not VLA-4 adhesiveness developed under shear flow conditions.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19571252 2009 The extracellular domain of CD11d regulates its cell surface expression.
19568411 2009 Defective infiltration of natural killer cells in MICA/B-positive renal cell carcinoma involves beta(2)-integrin-mediated interaction.
19446361 2009 Cathepsin X prevents an effective immune response against Helicobacter pylori infection.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19372628 2009 Airway inflammation and upregulation of beta2 Mac-1 integrin expression on circulating leukocytes of female ragpickers in India.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19360456 2009 Clinical significance of co-expression of CD21 and LFA-1 in B-cell lymphoma.
19353432 2009 Increased expression of cell adhesion molecules in inflammatory myopathies: diagnostic utility and pathogenetic insights.
19353220 2009 The value of leukocyte adhesion molecules in patients after ischemic stroke.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19340879 2009 Differential expression of leukocyte functions associated antigen-1 (LFA-1) on peripheral blood mononuclear cells in patients with Crohn's disease.
19307784 2009 Human leukocyte transmigration across Galalpha(1,3)Gal-negative porcine endothelium is regulated by human CD18 and CD99.
19290459 2009 Beta2-integrin-mediated adhesion and intracellular Ca2+ release in human eosinophils.
19264679 2009 Neutrophils phagocytose activated platelets in vivo: a phosphatidylserine, P-selectin, and {beta}2 integrin-dependent cell clearance program.
19261694 2009 In contrast to anti-tumor activity, YT cell and primary NK cell cytotoxicity for Cryptococcus neoformans bypasses LFA-1.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19234221 2009 c-Abl kinase is required for beta 2 integrin-mediated neutrophil adhesion.
19234188 2009 Analysis of adhesion molecules, target cells, and role of IL-2 in human FOXP3+ regulatory T cell suppressor function.
19175917 2009 Chemokines are secreted by monocytes following OK-432 (lyophilized Streptococcus pyogenes) stimulation.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139946 2009 Beta2-integrin activation on T cell subsets is an independent prognostic factor in unstable angina pectoris.
19136961 2009 Regulation of conformer-specific activation of the integrin LFA-1 by a chemokine-triggered Rho signaling module.
19135988 2009 Increased monocyte alphaL, alphaM and beta2 integrin subunits in diabetes mellitus.
19086264 2008 The atypical zeta (zeta) isoform of protein kinase C regulates CD11b/CD18 activation in human neutrophils.
19073595 2009 The heparan sulfate proteoglycan form of epithelial CD44v3 serves as a CD11b/CD18 counter-receptor during polymorphonuclear leukocyte transepithelial migration.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19052753 2009 Decrease in adhesion molecules on polymorphonuclear leukocytes of patients with fibromyalgia.
19029120 2009 Disruption of the integrin alphaLbeta2 transmembrane domain interface by beta2 Thr-686 mutation activates alphaLbeta2 and promotes micro-clustering of the alphaL subunits.
18955128 2009 Stress-induced changes in the expression of monocytic beta2-integrins: the impact of arousal of negative affect and adrenergic responses to the Anger Recall Interview.
18941116 2009 Ligand-engaged urokinase-type plasminogen activator receptor and activation of the CD11b/CD18 integrin inhibit late events of HIV expression in monocytic cells.
18922916 2008 Cell motility in chronic lymphocytic leukemia: defective Rap1 and alphaLbeta2 activation by chemokine.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18829897 2008 Inhibition of Na+/H+ exchanger enhances low pH-induced L-selectin shedding and beta2-integrin surface expression in human neutrophils.
18820737 2008 Signal regulatory protein alpha negatively regulates beta2 integrin-mediated monocyte adhesion, transendothelial migration and phagocytosis.
18818407 2008 Pathophysiological levels of soluble P-selectin mediate adhesion of leukocytes to the endothelium through Mac-1 activation.
18802065 2008 Monocyte migration and LFA-1-mediated attachment to brain microvascular endothelia is regulated by SDF-1 alpha through Lyn kinase.
18789886 2008 Beta2 integrins target Rap GTPases to the plasma membrane by means of degranulation.
18755982 2008 CD18-dependent activation of the neutrophil NADPH oxidase during phagocytosis of Escherichia coli or Staphylococcus aureus is regulated by class III but not class I or II PI3Ks.
18714035 2008 Neutrophil apoptosis: selective regulation by different ligands of integrin alphaMbeta2.
18685529 2008 The effect of aerobic exercise on neutrophil functions.
18676132 2009 Down regulation of CD11b and CD18 expression in children with hypercholesterolemia: a preliminary report.
18675632 2008 The ITGB2 immunomodulatory gene (CD18), enterocolitis, and Hirschsprung's disease.
18644795 2008 Urokinase-type plasminogen activator receptor induces conformational changes in the integrin alphaMbeta2 headpiece and reorientation of its transmembrane domains.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18626404 2008 Decreasing the expression of LFA-1 and ICAM-1 as the major mechanism for the protective effect of erythropoietin on ischemia-reperfusion injury.
18617697 2008 Myeloperoxidase delays neutrophil apoptosis through CD11b/CD18 integrins and prolongs inflammation.
18587400 2008 Nonmuscle myosin light-chain kinase mediates neutrophil transmigration in sepsis-induced lung inflammation by activating beta2 integrins.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18550856 2008 Beta2 integrin phosphorylation on Thr758 acts as a molecular switch to regulate 14-3-3 and filamin binding.
18509085 2008 Expression, activation, and function of integrin alphaMbeta2 (Mac-1) on neutrophil-derived microparticles.
18495784 2008 Postnatal maturation of total cell content and up-regulated surface expression of Mac-1 (CD11b/CD18) in polymorphonuclear leukocytes of human infants.
18414903 2008 Expression of CD11b/CD18 adhesion molecules on circulating phagocytes-a novel aid to diagnose infection in patients with cancer.
18397383 2008 The role of beta2 integrins and lipopolysaccharide-binding protein in the phagocytosis of dead Neisseria meningitidis.
18375764 2008 RTX cytotoxins recognize beta2 integrin receptors through N-linked oligosaccharides.
18369341 2008 Gene-environment association of an ITGB2 sequence variant with obesity in ethnic Japanese.
18367725 2008 Proline-rich tyrosine kinase 2 regulates spreading and migration of eosinophils after beta2-integrin adhesion.
18322203 2008 Structural insight into the function of myelin basic protein as a ligand for integrin alpha M beta 2.
18306933 2007 Analysis of gene expression profiles reveals novel correlations with the clinical course of colorectal cancer.
18279666 2008 Heterodimerization of integrin Mac-1 subunits studied by single-molecule imaging.
18199704 2008 Two-dimensional kinetics of beta 2-integrin and ICAM-1 bindings between neutrophils and melanoma cells in a shear flow.
18191791 2008 Integrin subunit CD18 Is the T-lymphocyte receptor for the Helicobacter pylori vacuolating cytotoxin.
18174366 2008 VIP differentially activates beta2 integrins, CR1, and matrix metalloproteinase-9 in human monocytes through cAMP/PKA, EPAC, and PI-3K signaling pathways via VIP receptor type 1 and FPRL1.
18164590 2008 Tumor necrosis factor-alpha (TNF-alpha) induces integrin CD11b/CD18 (Mac-1) up-regulation and migration to the CC chemokine CCL3 (MIP-1alpha) on human neutrophils through defined signalling pathways.
18076013 2008 Multimarker phenotype predicts adverse survival in patients with lymph node-negative colorectal cancer.
18065787 2008 Intracellular acidification enhances neutrophil phagocytosis in chronic haemodialysis patients: possible role of CD11b/CD18.
18057877 2008 Association of human platelet alloantigen 1 through 5 polymorphisms with ischemic stroke.
18032709 2008 Activation of Epac stimulates integrin-dependent homing of progenitor cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17996943 2008 LFA-1-mediated leukocyte adhesion regulated by interaction of CD43 with LFA-1 and CD147.
17900957 2007 Involvement of beta 2-integrin in ROS-mediated neutrophil apoptosis induced by Entamoeba histolytica.
17875809 2008 Reversion mutations in patients with leukocyte adhesion deficiency type-1 (LAD-1).
17726152 2007 Interactions of TANGO and leukocyte integrin CD11c/CD18 regulate the migration of human monocytes.
17721605 2007 Neutrophil activation via beta2 integrins (CD11/CD18): molecular mechanisms and clinical implications.
17719638 2008 The context of HLA-DR/CD18 complex in the plasma membrane governs HLA-DR-derived signals in activated monocytes.
17716608 2007 Hemofiltration and immune response in severe sepsis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17676580 2008 Fluid shear-induced activation and cleavage of CD18 during pseudopod retraction by human neutrophils.
17673459 2007 A structural hypothesis for the transition between bent and extended conformations of the leukocyte beta2 integrins.
17644514 2007 Beta2-integrins and acquired glycoprotein IIb/IIIa (GPIIb/IIIa) receptors cooperate in NF-kappaB activation of human neutrophils.
17635865 2007 Human CD18 is the functional receptor for Aggregatibacter actinomycetemcomitans leukotoxin.
17591777 2007 The cytosolic protein talin induces an intermediate affinity integrin alphaLbeta2.
17531998 2008 Endothelial and leukocyte adhesion molecules in primary hypertriglyceridemia.
17522381 2007 Characterization of two novel LPS-binding sites in leukocyte integrin betaA domain.
17468108 2007 Mutation of a conserved asparagine in the I-like domain promotes constitutively active integrins alphaLbeta2 and alphaIIbbeta3.
17346796 2007 Stable adhesion and migration of human neutrophils requires phospholipase D-mediated activation of the integrin CD11b/CD18.
17321526 2007 Cytoskeletal protein radixin activates integrin alpha(M)beta(2) by binding to its cytoplasmic tail.
17311314 2007 alpha subunit partners to beta1 and beta2 integrins during IL-4-induced foreign body giant cell formation.
17222807 2007 S100A9 mediates neutrophil adhesion to fibronectin through activation of beta2 integrins.
17107954 2007 Phosphorylation of the LFA-1 integrin beta2-chain on Thr-758 leads to adhesion, Rac-1/Cdc42 activation, and stimulation of CD69 expression in human T cells.
17016617 2006 Genetic risk for atherothrombotic cerebral infarction in individuals stratified by sex or conventional risk factors for atherosclerosis.
16963453 2006 Nitric oxide produced in response to engagement of beta2 integrins on human neutrophils activates the monomeric GTPases Rap1 and Rap2 and promotes adhesion.
16915040 2006 Telmisartan inhibits beta2-integrin MAC-1 expression in human T-lymphocytes.
16901728 2006 Cytoskeletal regulation couples LFA-1 conformational changes to receptor lateral mobility and clustering.
16846215 2006 Mac-1 promotes FcgammaRIIA-dependent cell spreading and migration on immune complexes.
16831868 2006 Mast cell costimulation by CD226/CD112 (DNAM-1/Nectin-2): a novel interface in the allergic process.
16782049 2006 Detection of constitutive heterodimerization of the integrin Mac-1 subunits by fluorescence resonance energy transfer in living cells.
16774752 2006 Carboxypeptidase cathepsin X mediates beta2-integrin-dependent adhesion of differentiated U-937 cells.
16764927 2007 beta2 Integrins are characteristically absent in acute promyelocytic leukemia and rapidly upregulated in vivo upon differentiation with all-trans retinoic acid.
16506060 2006 The effects of intensive, moderate and downhill treadmill running on human blood lymphocytes expressing the adhesion/activation molecules CD54 (ICAM-1), CD18 (beta2 integrin) and CD53.
16505487 2006 Transition from rolling to firm adhesion can be mimicked by extension of integrin alphaLbeta2 in an intermediate affinity state.
16492228 2006 Proinflammatory cytokines, adhesion molecules, and lymphocyte integrin expression in the internal jugular blood of migraine patients without aura assessed ictally.
16467205 2006 Integrin inhibition through Lyn-dependent cross talk from CXCR4 chemokine receptors in normal human CD34+ marrow cells.
16415171 2006 Platelet binding to monocytes increases the adhesive properties of monocytes by up-regulating the expression and functionality of beta1 and beta2 integrins.
16403785 2006 Lipoprotein(a) in atherosclerotic plaques recruits inflammatory cells through interaction with Mac-1 integrin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16301335 2005 Specific integrin alpha and beta chain phosphorylations regulate LFA-1 activation through affinity-dependent and -independent mechanisms.
16239529 2005 Influence of CR3 (CD11b/CD18) expression on phagocytosis of Bordetella pertussis by human neutrophils.
16037628 2005 Deep venous thrombosis: behaviour of the polymorphonuclear leukocyte integrin pattern at baseline and after in vitro activation.
15965234 2005 The crystal structure of the plexin-semaphorin-integrin domain/hybrid domain/I-EGF1 segment from the human integrin beta2 subunit at 1.8-A resolution.
15958383 2005 Epitope mapping of monoclonal antibody to integrin alphaL beta2 hybrid domain suggests different requirements of affinity states for intercellular adhesion molecules (ICAM)-1 and ICAM-3 binding.
15802551 2005 Regulation of interleukin-5-induced beta2-integrin adhesion of human eosinophils by phosphoinositide 3-kinase.
15741160 2005 The macrophage alphaMbeta2 integrin alphaM lectin domain mediates the phagocytosis of chilled platelets.
15665082 2005 Exposure of acidic residues as a danger signal for recognition of fibrinogen and other macromolecules by integrin alphaXbeta2.
15641787 2005 Interaction of fibrin(ogen) with leukocyte receptor alpha M beta 2 (Mac-1): further characterization and identification of a novel binding region within the central domain of the fibrinogen gamma-module.
15615722 2005 Dual function for a unique site within the beta2I domain of integrin alphaMbeta2.
15558232 2004 Monocytic expression of CD14 and CD18, circulating adhesion molecules and inflammatory markers in women with diabetes mellitus and impaired glucose tolerance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485828 2005 Distinct roles for the alpha and beta subunits in the functions of integrin alphaMbeta2.
15454120 2004 Concentration-dependent activity of mometasone furoate and dexamethasone on blood eosinophils isolated from atopic children: modulation of Mac-1 expression and chemotaxis.
15356110 2004 LFA-1 contributes an early signal for NK cell cytotoxicity.
15328156 2005 LDL-receptor-related protein regulates beta2-integrin-mediated leukocyte adhesion.
15304494 2004 Multiple binding sites in fibrinogen for integrin alphaMbeta2 (Mac-1).
15294914 2004 Association of BAP31 with CD11b/CD18. Potential role in intracellular trafficking of CD11b/CD18 in neutrophils.
15258348 2004 Polymorphonuclear leukocyte: rheology, metabolism and integrin pattern in vascular atherosclerotic disease and in type 2 diabetes mellitus.
15241561 2004 Adhesion dependent release of hepatocyte growth factor and interleukin-1 receptor antagonist from human blood granulocytes and monocytes: evidence for the involvement of plasma IgG, complement C3 and beta2 integrin.
15235127 2004 Leukocyte adhesion during hypoxia is mediated by HIF-1-dependent induction of beta2 integrin gene expression.
15187162 2004 Shear-dependent capping of L-selectin and P-selectin glycoprotein ligand 1 by E-selectin signals activation of high-avidity beta2-integrin on neutrophils.
15181567 2004 Increased adhesion molecule and chemokine receptor expression on CD8+ T cells trafficking to cerebrospinal fluid in HIV-1 infection.
15090462 2004 Characterization of plasminogen as an adhesive ligand for integrins alphaMbeta2 (Mac-1) and alpha5beta1 (VLA-5).
14769799 2004 Integrin alphaMbeta2 orchestrates and accelerates plasminogen activation and fibrinolysis by neutrophils.
14748512 2003 GPI-80, a beta2 integrin associated glycosylphosphatidylinositol-anchored protein, concentrates on pseudopodia without association with beta2 integrin during neutrophil migration.
14722085 2004 RanBPM is a phosphoprotein that associates with the plasma membrane and interacts with the integrin LFA-1.
14702343 2004 Rap1-mediated lymphocyte function-associated antigen-1 activation by the T cell antigen receptor is dependent on phospholipase C-gamma1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676297 2003 CD226 (DNAM-1) is involved in lymphocyte function-associated antigen 1 costimulatory signal for naive T cell differentiation and proliferation.
14576361 2004 Aggregation of beta2 integrins activates human neutrophils through the IkappaB/NF-kappaB pathway.
14512306 2004 Unique CD18 mutations involving a deletion in the extracellular stalk region and a major truncation of the cytoplasmic domain in a patient with leukocyte adhesion deficiency type 1.
14502280 2003 Differential requirement for CD18 in T-helper effector homing.
14500982 2003 Bidirectional transmembrane signaling by cytoplasmic domain separation in integrins.
13679375 2003 Integrin alpha2beta1 inhibits Fas-mediated apoptosis in T lymphocytes by protein phosphatase 2A-dependent activation of the MAPK/ERK pathway.
12960243 2003 Interaction of proteinase 3 with CD11b/CD18 (beta2 integrin) on the cell membrane of human neutrophils.
12952972 2003 High molecular weight kininogen regulates platelet-leukocyte interactions by bridging Mac-1 and glycoprotein Ib.
12885943 2003 A role for Syk-kinase in the control of the binding cycle of the beta2 integrins (CD11/CD18) in human polymorphonuclear neutrophils.
12885870 2003 Vav1 phosphorylation is induced by beta2 integrin engagement on natural killer cells upstream of actin cytoskeleton and lipid raft reorganization.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12847278 2003 Modulation of CD11b/CD18 adhesive activity by its extracellular, membrane-proximal regions.
12824186 2003 Identification of a negatively charged peptide motif within the catalytic domain of progelatinases that mediates binding to leukocyte beta 2 integrins.
12816955 2003 The fourth blade within the beta-propeller is involved specifically in C3bi recognition by integrin alpha M beta 2.
12771186 2003 Phagosomal oxidative activity during beta2 integrin (CR3)-mediated phagocytosis by neutrophils is triggered by a non-restricted Ca2+ signal: Ca2+ controls time not space.
12760968 2003 Priming of eosinophil migration across lung epithelial cell monolayers and upregulation of CD11b/CD18 are elicited by extracellular Ca2+.
12731070 2003 Fibrinogen-CD11b/CD18 interaction activates the NF-kappa B pathway and delays apoptosis in human neutrophils.
12694184 2003 Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins.
12682249 2003 Threonine phosphorylation sites in the beta 2 and beta 7 leukocyte integrin polypeptides.
12676940 2003 Down-regulation of Rac activity during beta 2 integrin-mediated adhesion of human neutrophils.
12643440 2002 Strong LFA-1 and VCAM-1 expression in histological type II of rheumatoid arthritis.
12617168 2002 Activation of leukocyte beta2-integrins.
12600815 2003 Interleukin-3, -5, and granulocyte macrophage colony-stimulating factor-induced adhesion molecule expression on eosinophils by p38 mitogen-activated protein kinase and nuclear factor-[kappa] B.
12576754 2003 Increased respiratory burst and increased expression of complement receptor-3 (CD11b/CD18) and of IL-8 receptor-A in neutrophil granulocytes from newborns after vaginal delivery.
12529399 2003 R-Ras promotes focal adhesion formation through focal adhesion kinase and p130(Cas) by a novel mechanism that differs from integrins.
12516552 2002 Adhesion of dendritic cells derived from CD34+ progenitors to resting human dermal microvascular endothelial cells is down-regulated upon maturation and partially depends on CD11a-CD18, CD11b-CD18 and CD36.
12511588 2003 A novel form of integrin dysfunction involving beta1, beta2, and beta3 integrins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444150 2002 Function of the lectin domain of Mac-1/complement receptor type 3 (CD11b/CD18) in regulating neutrophil adhesion.
12393547 2003 Convergence of the adhesive and fibrinolytic systems: recognition of urokinase by integrin alpha Mbeta 2 as well as by the urokinase receptor regulates cell adhesion and migration.
12390020 2002 Regulated unmasking of the cryptic binding site for integrin alpha M beta 2 in the gamma C-domain of fibrinogen.
12379807 2002 Cytosolic free Ca(2+) changes and calpain activation are required for beta integrin-accelerated phagocytosis by human neutrophils.
12377941 2002 Evidence that TNF-induced respiratory burst of adherent PMN is mediated by integrin alpha(L)beta(2).
12377937 2002 Stimulation of neutrophil apoptosis by immobilized IgA.
12377933 2002 Defective migration of monocyte-derived dendritic cells in LAD-1 immunodeficiency.
12377763 2002 A molecular basis for integrin alphaMbeta 2 ligand binding promiscuity.
12368274 2002 Transition from rolling to firm adhesion is regulated by the conformation of the I domain of the integrin lymphocyte function-associated antigen-1.
12324470 2002 Identification of functional segments within the beta2I-domain of integrin alphaMbeta2.
12244179 2002 Mac-1 (CD11b/CD18) as accessory molecule for Fc alpha R (CD89) binding of IgA.
12207338 2002 Bacterial fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12200369 2002 The caspase inhibitor z-VAD is more effective than CD18 adhesion blockade in reducing muscle ischemia-reperfusion injury: implication for clinical trials.
12183834 2002 Decreased stroma adhesion capacity of CD34+ progenitor cells from mobilized peripheral blood is not lineage- or stage-specific and is associated with low beta 1 and beta 2 integrin expression.
12171996 2002 The small GTPase Rap1 is required for Mn(2+)- and antibody-induced LFA-1- and VLA-4-mediated cell adhesion.
12163503 2002 Chemokine stimulation of lymphocyte alpha 4 integrin avidity but not of leukocyte function-associated antigen-1 avidity to endothelial ligands under shear flow requires cholesterol membrane rafts.
12145463 2002 Increased CD11/CD18 expression and altered metabolic activity on polymorphonuclear leukocytes from patients with polycythemia vera and essential thrombocythemia.
12139949 2002 Alteration in expression of beta 2 integrins on lamina propria lymphocytes in ulcerative colitis and Crohn's disease.
12097820 Both ICAM-1- and VCAM-1-integrin interactions are important in mediating monocyte adhesion to human saphenous vein.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12056825 2002 Physical association of beta 2 integrin with GPI-80, a novel glycosylphosphatidylinositol-anchored protein with potential for regulating adhesion and migration.
12050191 2002 Protein kinase A regulates beta2 integrin avidity in neutrophils.
11986332 2002 beta 1 integrin regulates fibroblast viability during collagen matrix contraction through a phosphatidylinositol 3-kinase/Akt/protein kinase B signaling pathway.
11967116 2002 Haptoglobin interacts with the human mast cell line HMC-1 and inhibits its spontaneous proliferation.
11953106 2002 [Study of the function of leukocyte adhesion molecules in chronic respiratory diseases].
11937543 2002 During differentiation of the monocytic cell line U937, Pur alpha mediates induction of the CD11c beta 2 integrin gene promoter.
11935032 2002 A prospective evaluation of the CD14 and CD18 gene polymorphisms and risk of stroke.
11931654 2002 beta1 and beta2 integrins activate different signalling pathways in monocytes.
11922836 2002 Structural and ICAM-1-docking properties of a cyclic peptide from the I-domain of LFA-1: an inhibitor of ICAM-1/LFA- 1-mediated T-cell adhesion.
11914080 2002 The role of the specificity-determining loop of the integrin beta subunit I-like domain in autonomous expression, association with the alpha subunit, and ligand binding.
11857637 2002 Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.
11843895 2002 Activation of granulocytes in patients treated with chemotherapy.
11838958 2001 Down-regulation of cell adhesion molecules LFA-1 and ICAM-1 after in vitro treatment with the anti-TNF-alpha agent thalidomide.
11831866 Hematologically important mutations: leukocyte adhesion deficiency.
11823004 2002 Expression of CD16, CD18 and CD56 in tributyltin-exposed human natural killer cells.
11818440 2002 Cross-linking of GPI-80, a possible regulatory molecule of cell adhesion, induces up-regulation of CD11b/CD18 expression on neutrophil surfaces and shedding of L-selectin.
11812992 2002 JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.
11751951 2002 NK cell activation by dendritic cells is dependent on LFA-1-mediated induction of calcium-calmodulin kinase II: inhibition by HIV-1 Tat C-terminal domain.
11745332 2001 Lipopolysaccharide and ceramide docking to CD14 provokes ligand-specific receptor clustering in rafts.
11703955 2001 Association of a CD18 gene polymorphism with a reduced risk of restenosis after coronary stenting.
11700305 2002 Phosphorylation of the cytoplasmic domain of the integrin CD18 chain by protein kinase C isoforms in leukocytes.
11544294 2001 Human endothelial-cell specific molecule-1 binds directly to the integrin CD11a/CD18 (LFA-1) and blocks binding to intercellular adhesion molecule-1.
11477072 2001 The N-terminal region and the mid-region complex of the integrin beta 2 subunit.
11353828 2001 Reversibly locking a protein fold in an active conformation with a disulfide bond: integrin alphaL I domains with high affinity and antagonist activity in vivo.
11279101 2001 Association of the membrane proximal regions of the alpha and beta subunit cytoplasmic domains constrains an integrin in the inactive state.
10961871 2000 Pyk2 and Syk participate in functional activation of granulocytic HL-60 cells in a different manner.
10906324 2000 The LIM-only protein DRAL/FHL2 binds to the cytoplasmic domain of several alpha and beta integrin chains and is recruited to adhesion complexes.
10846180 2000 Binding sites of leukocyte beta 2 integrins (LFA-1, Mac-1) on the human ICAM-4/LW blood group protein.
10845911 2000 Cleaved high molecular weight kininogen binds directly to the integrin CD11b/CD18 (Mac-1) and blocks adhesion to fibrinogen and ICAM-1.
10835351 2000 Cytohesin-1 regulates beta-2 integrin-mediated adhesion through both ARF-GEF function and interaction with LFA-1.
10830953 2000 The DNA sequence of human chromosome 21.
10766246 2000 Integrin LFA-1 interacts with the transcriptional co-activator JAB1 to modulate AP-1 activity.
10712675 2000 A novel CD18 genomic deletion in a patient with severe leucocyte adhesion deficiency: a possible CD2/lymphocyte function-associated antigen-1 functional association in humans.
10602019 1999 Overexpression of CD82 on human T cells enhances LFA-1 / ICAM-1-mediated cell-cell adhesion: functional association between CD82 and LFA-1 in T cell activation.
10591186 1999 Physical and functional association of LFA-1 with DNAM-1 adhesion molecule.
10548107 1999 Extraintestinal dissemination of Salmonella by CD18-expressing phagocytes.
9884339 1999 A novel leukocyte adhesion deficiency caused by expressed but nonfunctional beta2 integrins Mac-1 and LFA-1.
9786897 1998 Mapping the intercellular adhesion molecule-1 and -2 binding site on the inserted domain of leukocyte function-associated antigen-1.
9736715 1998 Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.
9442085 1998 Rack1, a receptor for activated protein kinase C, interacts with integrin beta subunit.
8995416 1997 cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.
8757599 1996 HIV-1-Tat protein promotes chemotaxis and invasive behavior by monocytes.
8649427 1996 An SH3 domain-containing GTPase-activating protein for Rho and Cdc42 associates with focal adhesion kinase.
8568270 1996 HIV-1-Tat modulates the function of monocytes and alters their interactions with microvessel endothelial cells. A mechanism of HIV pathogenesis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7902162 1993 Retroviral mediated expression of CD18 in normal and deficient human bone marrow progenitor cells.
7846055 1995 CD18 (beta 2 leukocyte integrin) promoter requires PU.1 transcription factor for myeloid activity.
7822326 1995 Analysis of the binding site on intercellular adhesion molecule 3 for the leukocyte integrin lymphocyte function-associated antigen 1.
7686755 1993 A point mutation associated with leukocyte adhesion deficiency type 1 of moderate severity.
7642561 1995 A binding interface on the I domain of lymphocyte function-associated antigen-1 (LFA-1) required for specific interaction with intercellular adhesion molecule 1 (ICAM-1).
7621072 1995 CD23 regulates monocyte activation through a novel interaction with the adhesion molecules CD11b-CD18 and CD11c-CD18.
7514637 1994 Zymosan-induced IL-8 release from human neutrophils involves activation via the CD11b/CD18 receptor and endogenous platelet-activating factor as an autocrine modulator.
7509236 1993 Familial genetic defect in a case of leukocyte adhesion deficiency.
3899217 1985 Characterization of patients with an increased susceptibility to bacterial infections and a genetic deficiency of leukocyte membrane complement receptor type 3 and the related membrane antigen LFA-1.
3887182 1985 Sequence homology of the LFA-1 and Mac-1 leukocyte adhesion glycoproteins and unexpected relation to leukocyte interferon.
3594570 1987 Heterogeneous mutations in the beta subunit common to the LFA-1, Mac-1, and p150,95 glycoproteins cause leukocyte adhesion deficiency.
3528378 1986 LFA-1 immunodeficiency disease. Definition of the genetic defect and chromosomal mapping of alpha and beta subunits of the lymphocyte function-associated antigen 1 (LFA-1) by complementation in hybrid cells.
3519653 1986 Clinical and laboratory features of patients with an inherited deficiency of neutrophil membrane complement receptor type 3 (CR3) and the related membrane antigens LFA-1 and p150,95.
3305706 1987 Monoclonal antibodies that recognize lacto-N-fucopentaose III (CD15) react with the adhesion-promoting glycoprotein family (LFA-1/HMac-1/gp 150,95) and CR1 on human neutrophils.
3278007 1988 A monoclonal antibody to the adherence-promoting leukocyte glycoprotein, CD18, reduces organ injury and improves survival from hemorrhagic shock and resuscitation in rabbits.
3073708 1988 Regional localization of CD18, the beta-subunit of the cell surface adhesion molecule LFA-1, on human chromosome 21 by in situ hybridization.
3028646 1987 Cloning of the beta subunit of the leukocyte adhesion proteins: homology to an extracellular matrix receptor defines a novel supergene family.
2964960 1988 The expression of CD18 is increased on Trisomy 21 (Down syndrome) lymphoblastoid cells.
2955527 1987 Chromosomal assignments of genes coding for human leukocyte common antigen, T-200, and lymphocyte function-associated antigen 1, LFA-1 beta subunit.
2954816 1987 The primary structure of the beta-subunit of the cell surface adhesion glycoproteins LFA-1, CR3 and p150,95 and its relationship to the fibronectin receptor.
2454931 1988 Amino acid sequence of the alpha subunit of human leukocyte adhesion receptor Mo1 (complement receptor type 3).
2150484 1990 The PMA-induced specific association of LFA-1 and talin in intact cloned T helper cells.
1972597 1990 Correction of CD18-deficient lymphocytes by retrovirus-mediated gene transfer.
1968911 1990 Point mutations impairing cell surface expression of the common beta subunit (CD18) in a patient with leukocyte adhesion molecule (Leu-CAM) deficiency.
1968909 1990 Transfection of cells from patients with leukocyte adhesion deficiency with an integrin beta subunit (CD18) restores lymphocyte function-associated antigen-1 expression and function.
1694220 1990 Distinct mutations in two patients with leukocyte adhesion deficiency and their functional correlates.
1683838 1991 The gene organisation of the human beta 2 integrin subunit (CD18).
1674496 1991 A genetic linkage map of 27 markers on human chromosome 21.
1590804 1992 Leukocyte adhesion deficiency: identification of novel mutations in two Japanese patients with a severe form.
1352501 1992 Molecular basis for a severe case of leukocyte adhesion deficiency.
1347532 1992 Identification of two molecular defects in a child with leukocyte adherence deficiency.
1346613 1992 Genetic cause of leukocyte adhesion molecule deficiency. Abnormal splicing and a missense mutation in a conserved region of CD18 impair cell surface expression of beta 2 integrins.