Property Summary

Ligand Count 3
NCBI Gene PubMed Count 1,031
PubMed Score 986.94
PubTator Score 1124.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Osteopetrosis 43 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 3.400 3.8e-02
Astrocytoma, Pilocytic 1.300 1.6e-06
axial spondyloarthropathy 1.100 3.2e-02
colon cancer -2.700 2.1e-07
glioblastoma 1.300 2.6e-03
interstitial cystitis 1.300 8.6e-05
malignant mesothelioma -1.700 1.5e-06
osteosarcoma 1.448 1.1e-03
ovarian cancer 1.100 1.9e-03
pancreatic cancer 1.600 3.3e-03
pancreatic carcinoma 1.600 3.3e-03
pediatric high grade glioma 1.300 7.7e-04
tuberculosis 1.200 1.5e-02

Protein-protein Interaction (1)

PDB (64)

Gene RIF (954)

AA Sequence

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENL      1 - 70
LKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDI     71 - 140
YYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTC    141 - 210
LPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKT    211 - 280
HIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSEL    281 - 350
IPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT    351 - 420
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP    421 - 490
GWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGE    491 - 560
MCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTC    561 - 630
PDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS    631 - 700
GKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANN    701 - 770
PLYKEATSTFTNITYRGT                                                        771 - 788
//

Text Mined References (1044)

PMID Year Title