Property Summary

Ligand Count 3
NCBI Gene PubMed Count 1,031
PubMed Score 986.94
PubTator Score 1124.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Osteopetrosis 43 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 3.400 3.8e-02
Astrocytoma, Pilocytic 1.300 1.6e-06
axial spondyloarthropathy 1.100 3.2e-02
colon cancer -2.700 2.1e-07
glioblastoma 1.300 2.6e-03
interstitial cystitis 1.300 8.6e-05
malignant mesothelioma -1.700 1.5e-06
osteosarcoma 1.448 1.1e-03
ovarian cancer 1.100 1.9e-03
pancreatic cancer 1.600 3.3e-03
pancreatic carcinoma 1.600 3.3e-03
pediatric high grade glioma 1.300 7.7e-04
tuberculosis 1.200 1.5e-02

Synonym

Accession P05106 A0PJW2 D3DXJ8 O15495 Q12806 Q13413 Q14648 Q16499
Symbols GT
CD61
GP3A
BDPLT2
GPIIIa
BDPLT16

Gene

PDB

4MMX   4MMY   4MMZ   2VDO   2VDP   2VDQ   2VDR   2Q6W   1KUP   1KUZ   1M8O   1RN0   1TYE   2K9J   2KNC   2MTP   2N9Y   2VC2   2VDK   2VDL   2VDM   2VDN   3FCS   3FCU   3NID   3NIF   3NIG   3T3M   3T3P   3ZDX   3ZDY   3ZDZ   3ZE0   3ZE1   3ZE2   4CAK   4Z7N   4Z7O   4Z7Q   5HDB   1JV2   1L5G   1M1X   1MIZ   1MK7   1MK9   1S4X   1U8C   2INI   2KV9   2L1C   2L91   2LJD   2LJE   2LJF   2RMZ   2RN0   3IJE   4G1E   4G1M   4O02   6AVQ   6AVR   6AVU  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Protein-protein Interaction (1)

Gene RIF (954)

AA Sequence

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENL      1 - 70
LKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDI     71 - 140
YYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTC    141 - 210
LPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKT    211 - 280
HIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSEL    281 - 350
IPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT    351 - 420
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP    421 - 490
GWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGE    491 - 560
MCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTC    561 - 630
PDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS    631 - 700
GKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANN    701 - 770
PLYKEATSTFTNITYRGT                                                        771 - 788
//

Text Mined References (1044)

PMID Year Title