Property Summary

NCBI Gene PubMed Count 971
Grant Count 97
R01 Count 49
Funding $10,806,567.46
PubMed Score 954.04
PubTator Score 1124.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 2.100 0.000
malignant mesothelioma -4.500 0.000
osteosarcoma 1.448 0.001
glioblastoma 1.300 0.003
tuberculosis 1.200 0.015
colon cancer -2.700 0.000
Breast cancer 3.400 0.038
interstitial cystitis 1.300 0.000
pediatric high grade glioma 1.300 0.001
pilocytic astrocytoma 1.200 0.000
pancreatic carcinoma 2.100 0.000
ovarian cancer 1.100 0.002
axial spondyloarthropathy 1.100 0.032

Synonym

Accession P05106 A0PJW2 D3DXJ8 O15495 Q12806 Q13413 Q14648 Q16499
Symbols GT
CD61
GP3A
BDPLT2
GPIIIa
BDPLT16

Gene

PDB

4MMX   4MMY   4MMZ   2VDO   2VDP   2VDQ   2VDR   2Q6W   1KUP   1KUZ   1M8O   1RN0   1TYE   2K9J   2KNC   2MTP   2N9Y   2VC2   2VDK   2VDL   2VDM   2VDN   3FCS   3FCU   3NID   3NIF   3NIG   3T3M   3T3P   3ZDX   3ZDY   3ZDZ   3ZE0   3ZE1   3ZE2   4CAK   4Z7N   4Z7O   4Z7Q   5HDB   1JV2   1L5G   1M1X   1MIZ   1MK7   1MK9   1S4X   1U8C   2INI   2KV9   2L1C   2L91   2LJD   2LJE   2LJF   2RMZ   2RN0   3IJE   4G1E   4G1M   4O02  

 GWAS Trait (1)

Gene RIF (906)

PMID Text
27239844 The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent
26867579 Monomeric fibrin displayed a higher probability of interacting with Integrin alphaIIb beta 3 and a greater binding strength.
26840189 CD61-overexpressing human umbilical cord mesenchymal stem cell, which had turned into primordial germ-like cells-like cells, could be further differentiated into male germ-like cells.
26829726 ITGB3 c.1476G>A mutation decrease the transcription level and affect GPIIIa synthesis and CD61 antigen expression.
26809135 There are no relationships between glycoprotein IIIa P1A1/A2 polymorphism, aspirin resistance and development of atherothrombotic stroke.
26800504 Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype
26781040 beta3 integrin downregulation by miR-30a-5p modulates cell adhesion and invasion by interrupting Erk/Ets1 network in triple-negative breast cancer
26717039 EGFRvIII/integrin beta3 interaction in hypoxic and vitronectinenriching microenvironment promote Glioblastoma progression and metastasis.
26688324 This study shows correlation of blood clot stiffness with platelet integrin alpha-IIb beta3 activity, aspirin usage, and transfusion risk in cardiopulmonary bypass patients.
26631735 Data suggest that the ligand AGDV tetrapeptide binds to ITGB3/GPIIIa subunit and induces complete opening of headpiece of integrin alphaIIb/beta3 complex; AGDV appears to have very little contact with ITGA2B/GPIIb subunit.
More...

AA Sequence

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENL      1 - 70
LKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDI     71 - 140
YYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTC    141 - 210
LPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKT    211 - 280
HIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSEL    281 - 350
IPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT    351 - 420
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP    421 - 490
GWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGE    491 - 560
MCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTC    561 - 630
PDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS    631 - 700
GKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANN    701 - 770
PLYKEATSTFTNITYRGT                                                        771 - 788
//

Text Mined References (985)

PMID Year Title
27239844 [Gene Polymorphism of the c-fms, ITGB3,CCR2, and DBH genes in the populations of old believers of the Tyumen oblast and Russian residents of Novosibirsk].
26867579 2016 The Platelet Integrin ?IIb?3 Differentially Interacts with Fibrin Versus Fibrinogen.
26840189 2016 Overexpression of CD61 promotes hUC-MSC differentiation into male germ-like cells.
26829726 2016 [Study of in vitro expression of human platelet ITGB3 gene nonsense mutation c.1476G>A].
26809135 2016 Aspirin resistance in cerebrovascular disease and the role of glycoprotein IIIa polymorphism in Turkish stroke patients.
26800504 2016 ADAM23 is downregulated in side population and suppresses lung metastasis of lung carcinoma cells.
26781040 2016 Downregulation of ?3 integrin by miR-30a-5p modulates cell adhesion and invasion by interrupting Erk/Ets?1 network in triple-negative breast cancer.
26717039 2016 EGFRvIII/integrin ?3 interaction in hypoxic and vitronectinenriching microenvironment promote GBM progression and metastasis.
26688324 2016 Sonorheometry assessment of platelet function in cardiopulmonary bypass patients: Correlation of blood clot stiffness with platelet integrin ?IIb?3 activity, aspirin usage, and transfusion risk.
26631735 2016 ?-Subunit Binding Is Sufficient for Ligands to Open the Integrin ?IIb?3 Headpiece.
More...