Property Summary

NCBI Gene PubMed Count 486
Grant Count 298
R01 Count 195
Funding $26,426,054.04
PubMed Score 1166.96
PubTator Score 1117.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Prostate cancer 172 5.647 2.8
Congenital adrenal hyperplasia 74 5.628 2.8
Polycystic Ovary Syndrome 332 5.571 2.8
Hyperandrogenism 32 4.926 2.5
Hypokalemia 40 4.833 2.4
Antley-Bixler syndrome 15 4.725 2.4
Amenorrhea 60 4.431 2.2
Hypertension 287 4.217 2.1
Pseudohermaphroditism 16 4.184 2.1
Breast cancer 3,094 4.083 2.0
Cushing's syndrome 47 4.079 2.0
Conn's syndrome 22 3.692 1.8
Hypospadias 65 3.615 1.8
Adenoma 165 3.572 1.8
Infertility 163 3.474 1.7
Premature ovarian failure 64 3.391 1.7
Adrenal cortical adenoma 10 3.359 1.7
adrenocortical carcinoma 1,427 3.311 1.7
Cryptorchidism 67 3.095 1.5
Hypogonadism 70 3.082 1.5
17,20-Lyase Deficiency, Isolated 1
Adrenal hyperplasia, congenital, type 5 2
Blastomycosis 12
Blood pressure finding 56
Candidiasis of mouth 5
Candidiasis of skin 6
Chromoblastomycosis 8
Coccidioidomycosis 7
Disseminated candidiasis 4
Essential Hypertension 82 2.0
Female infertility 28
Histoplasmosis 22
Hypercortisolism 8
Hyperkalemia 2
Hypopituitarism 36
Liver Cirrhosis, Experimental 108
Liver carcinoma 217
Male infertility 170
Malignant Hypertension 3
Malignant tumor of prostate 11
Mammary Neoplasms 410
Non-alcoholic Fatty Liver Disease 40
Oligomenorrhea 1
Ovarian Cysts 34
Paracoccidioidomycosis 11
Parkinson Disease 102
Parkinson's disease 364 2.0
Pityriasis simplex 6
Pityriasis versicolor 18
Prostatic Neoplasms 471
Psychosexual Disorders 6
Seborrheic dermatitis 19
Systemic arterial pressure 56
Tinea corporis 25
Tinea cruris 12
Tinea pedis 30
pancreatic ductal adenocarcinoma liver m... 1,795 

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.060 0.032

Synonym

Accession P05093 Q5TZV7
Symbols CPT7
CYP17
S17AH
P450C17

Gene

PANTHER Protein Class (2)

PDB

2C17   3RUK   3SWZ   4NKV   4NKW   4NKX   4NKY   4NKZ  

Gene RIF (498)

PMID Text
26973185 Interaction of novel oxazoline derivatives of 17(20)e-pregna-5,17(20)-diene with cytochrome P450 17A1
26940238 CYP17A1 rs3824755 and rs743572 are associated with Alzheimer's disease in the Chinese Han population and act in combination with APOE e4.
26902494 Polymorphism single nucleotide of CYP17A1 gene is implicated to the development of high blood pressure.
26719338 The FMN domain outcompetes b5 for binding to CYP17A1 in the three-component system
26668369 Data indicate that cytochrome P450 17A1 (CYP17A1) first catalyzes pregnenolone (PREG) and then converts the 17-hydroxypregnenolone initial product to dehydroepiandrosterone, a process representing the first committed step in the biosynthesis of androgens.
26634548 ESR1 may be associated with low mineral osseous densitometry, while CYP17 and COMT gene polymorphisms were not associated with mineral osseous densitometry.
26587646 We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.
26414697 genetic variants in the androgen-related genes CYP17A1 and JMJD1C might be associated with risk of Barrett's esophagus (BE) and esophageal adenocarcinoma (EAC).
26407154 Our study suggests no strong association between the CYP17A1 T27C and LEP -2548G>A polymorphisms and the incidence of breast cancer in Turkish women.
26345865 The compound heterozygous mutation of p. Thr101Ilefs*2 and p. Thr306Ale is a new gene mutation of 17alpha-hydroxylase/17, 20-lyase deficiency.
More...

AA Sequence

MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGT      1 - 70
KTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQ     71 - 140
KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLS    141 - 210
KDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGP    211 - 280
DQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRL    281 - 350
LLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP    351 - 420
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFK    421 - 490
VKIKVRQAWREAQAEGST                                                        491 - 508
//

Text Mined References (488)

PMID Year Title
26973185 [Interaction of novel oxazoline derivatives of 17(20)e-pregna-5,17(20)-diene with cytochrome P450 17A1].
26940238 2016 Association between CYP17A1 rs3824755 and rs743572 gene polymorphisms and Alzheimer's disease in the Chinese Han population.
26902494 2016 Common Polymorphisms at the CYP17A1 Locus Associate With Steroid Phenotype: Support for Blood Pressure Genome-Wide Association Study Signals at This Locus.
26719338 2016 Cytochrome P450 17A1 Interactions with the FMN Domain of Its Reductase as Characterized by NMR.
26668369 2015 Unveiling the crucial intermediates in androgen production.
26634548 2015 Polymorphisms in CYP17, COMT, and ESR1 genes in women after menopause and association with bone mineral density.
26587646 2015 Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1).
26414697 2016 Polymorphisms in genes in the androgen pathway and risk of Barrett's esophagus and esophageal adenocarcinoma.
26407154 2015 Evaluation of CYP17A1 and LEP Gene Polymorphisms in Breast Cancer.
26345865 2015 New compound heterozygous mutations of p. Thr101Ilefs 2 and p. Thr306Ale in a child from a Chinese family with 17?-hydroxylase/17, 20-lyase deficiency.
More...