Property Summary

Ligand Count 432
NCBI Gene PubMed Count 511
PubMed Score 1226.17
PubTator Score 1117.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 3.2e-02
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0
Parkinson's disease 392 0.0 2.9

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.060 3.2e-02

Gene RIF (522)

AA Sequence

MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGT      1 - 70
KTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQ     71 - 140
KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLS    141 - 210
KDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGP    211 - 280
DQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRL    281 - 350
LLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP    351 - 420
AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFK    421 - 490
VKIKVRQAWREAQAEGST                                                        491 - 508
//

Text Mined References (513)

PMID Year Title