Property Summary

Ligand Count 85
NCBI Gene PubMed Count 555
PubMed Score 1004.95
PubTator Score 980.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Alcoholism 45
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alcohol dependence 107 6.887 3.4

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 4.7e-07
breast carcinoma -1.100 2.2e-02
chronic lymphosyte leukemia -1.300 3.4e-08
ductal carcinoma in situ -2.000 7.8e-04
fibroadenoma -2.000 1.8e-02
glioblastoma -1.300 3.0e-05
group 3 medulloblastoma -1.500 1.1e-06
intraductal papillary-mucinous adenoma (... 1.300 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
invasive ductal carcinoma -2.200 3.4e-03
limb girdle muscular dystrophy 2B -1.172 4.6e-04
lung adenocarcinoma -1.400 1.5e-06
lung cancer -1.300 8.0e-05
medulloblastoma, large-cell -2.900 1.4e-06
non-small cell lung cancer -1.629 5.2e-18
ovarian cancer -2.000 8.5e-05
pancreatic ductal adenocarcinoma liver m... -1.405 2.0e-02
pediatric high grade glioma -1.300 9.5e-05
pituitary cancer -1.400 6.1e-06
primitive neuroectodermal tumor -1.200 9.0e-03
psoriasis 1.100 5.3e-04

PDB (27)

Gene RIF (594)

AA Sequence

MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAE      1 - 70
GDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLD     71 - 140
MVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKV    141 - 210
AEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLK    211 - 280
RVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGN    281 - 350
PFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP    351 - 420
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGS    421 - 490
GRELGEYGLQAYTEVKTVTVKVPQKNS                                               491 - 517
//

Text Mined References (559)

PMID Year Title