Property Summary

NCBI Gene PubMed Count 80
Grant Count 30
R01 Count 20
Funding $3,251,451.94
PubMed Score 275.12
PubTator Score 221.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
26829325 apoD protein levels are variable across different brain regions.
26083030 hepatic steatosis observed in apoD Tg mice is a consequence of increased PPARgamma transcriptional activity by AA leading to increased fatty acid uptake by the liver
25953740 The data suggest that the presence of Apo D in the nucleus, which some authors related with a specific transport, is a consequence of structural and functional alterations during oxidative stress
25918162 The internalization of apoD is mediated by basigin.
25513803 apoD mediates binding of high density lipoprotein to low density lipoprotein and to growing T24 carcinomas, thereby highlighting the importance of apoD in lipid metabolism.
25261976 The SNP rs7659 within the APOD gene might be related to risk and severity of ischemic stroke in patients.
24167586 We propose that strong brainstem expression of Apo D throughout adult life contributes to resistance against neurodegenerative disease and age-related degeneration, possibly by preventing oxidative stress and ensuing lipid peroxidation.
23895740 ApoD mRNA expression is seen in whole endometrium, stromal and epithelial cells in the secretory phase, as well as after hormonal stimulation in vitro.
23777559 Data suggest that ApoD binds various lyophilic ligands: retinoic acid, retinol, fatty acids, sphingomyelin, and anandamide. ApoD successfully delivers retinoic acid to immature neuronal cell line resulting in neurogenesis (i.e., neurite formation).
23715769 ApoE is located in the nucleus and on the ApoD promoter in human hepatic and glioblastoma cells lines.
More...

AA Sequence

MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME      1 - 70
NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL     71 - 140
FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS                         141 - 189
//

Text Mined References (86)

PMID Year Title
26829325 2016 Cerebral Apolipoprotein-D Is Hypoglycosylated Compared to Peripheral Tissues and Is Variably Expressed in Mouse and Human Brain Regions.
26083030 2015 Apolipoprotein D Transgenic Mice Develop Hepatic Steatosis through Activation of PPAR? and Fatty Acid Uptake.
25953740 2015 Apolipoprotein D subcellular distribution pattern in neuronal cells during oxidative stress.
25918162 2015 Apolipoprotein D Internalization Is a Basigin-dependent Mechanism.
25513803 2014 ApoD mediates binding of HDL to LDL and to growing T24 carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25261976 2014 Variations in apolipoprotein D and sigma non-opioid intracellular receptor 1 genes with relation to risk, severity and outcome of ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167586 2013 Lifelong expression of apolipoprotein D in the human brainstem: correlation with reduced age-related neurodegeneration.
23895740 2013 Cell-type specific expression and regulation of apolipoprotein D and E in human endometrium.
More...