Property Summary

NCBI Gene PubMed Count 86
PubMed Score 282.96
PubTator Score 221.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.026 3.2e-02
adrenocortical carcinoma -2.234 6.2e-05
Astrocytoma, Pilocytic 2.500 4.8e-08
Atopic dermatitis -2.200 8.9e-03
atypical teratoid / rhabdoid tumor -1.400 1.5e-02
breast carcinoma -2.000 1.8e-16
cystic fibrosis 1.500 1.2e-04
Down syndrome 1.500 1.8e-03
ependymoma -1.500 7.1e-04
group 3 medulloblastoma -2.000 1.5e-02
intraductal papillary-mucinous adenoma (... -2.100 8.1e-03
intraductal papillary-mucinous carcinoma... -2.900 2.4e-03
intraductal papillary-mucinous neoplasm ... -3.100 7.0e-03
invasive ductal carcinoma -2.111 6.0e-04
lung cancer -1.500 4.9e-02
malignant mesothelioma -2.100 7.1e-06
medulloblastoma, large-cell -1.300 1.1e-02
mucosa-associated lymphoid tissue lympho... 1.029 8.8e-03
non-small cell lung cancer -1.469 3.6e-06
osteosarcoma -3.467 5.0e-02
pancreatic cancer 1.200 2.8e-02
pituitary cancer -3.700 6.0e-06
psoriasis -2.100 1.0e-05
subependymal giant cell astrocytoma -3.550 5.4e-03

Protein-protein Interaction (5)

Gene RIF (56)

AA Sequence

MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME      1 - 70
NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL     71 - 140
FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS                         141 - 189
//

Text Mined References (92)

PMID Year Title