Property Summary

NCBI Gene PubMed Count 123
Grant Count 214
R01 Count 118
Funding $23,850,729.78
PubMed Score 537.56
PubTator Score 332.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 3.000 0.000
osteosarcoma -5.894 0.000
periodontitis -1.600 0.000
primitive neuroectodermal tumor -1.200 0.000
Atopic dermatitis -2.000 0.026
lung adenocarcinoma -1.800 0.000
mucosa-associated lymphoid tissue lympho... 2.847 0.027

Synonym

Accession P05089 A6NEA0 Q5JWT5 Q5JWT6 Q8TE72 Q9BS50
Symbols

Gene

PANTHER Protein Class (1)

PDB

1WVA   1WVB   2AEB   2PHA   2PHO   2PLL   2ZAV   3DJ8   3E6K   3E6V   3F80   3GMZ   3GN0   3KV2   3LP4   3LP7   3MFV   3MFW   3MJL   3SJT   3SKK   3TF3   3TH7   3THE   3THH   3THJ   4FCI   4FCK   4GSM   4GSV   4GSZ   4GWC   4GWD   4HWW   4HXQ   4IE1  

 OMIM Term (1)

Gene RIF (107)

PMID Text
26647762 These results showed that alterations in the expression levels of Arg I and iNOS in the peripheral T cells and peripheral nodes of HIV infected patients are associated with disease progression in these patients.
26571397 data indicate that helminth coinfection induces arginase-1-expressing type 2 granulomas, thereby increasing inflammation and TB disease severity.
26538654 Overexpression of Arg1 in the CNS of transgenic mice significantly reduced tau pathology.
26537638 ARG1 rs2781659 AA and rs2781667 TT genotypes were associated with lower IIEF scores (increased severity) in clinical erectile dysfunction (ED), whereas ARG1 GTCC haplotype is associated with higher IIEF scores in clinical ED, thus suggesting a genetic contribution of ARG1 variations to ED
26227111 This method not only solved the problem of obtaining a large amount of arginase, but also provided a promising alternative for the future industrial production of L-Orn.
26161395 the combination of high levels of CD14, FOXP3, and ARG1 mRNAs identified a small group of patients with excellent event-free and overall survival.
26126810 Arginase inhibition arrests human pulmonary artery smooth muscle cells in the G1/G0-phase under hypoxic conditions.
26119192 Arginase from neutrophils can modulate nitric oxide production from activated macrophages which may affect the course of infection by intracellular bacteria.
26061397 Increased ARG1 expression in macrophages after a single radiotherapy dose is an independent prognostic factor of skin toxicities.
26030248 Data indicate that arginase-1 showed positivity in 2 ampullary region carcinomas and diffuse positivity in 1 duodenal adenocarcinoma.
More...

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNP      1 - 70
RSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNL     71 - 140
HGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK    141 - 210
VMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP    211 - 280
SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK                                281 - 322
//

Text Mined References (125)

PMID Year Title
26647762 2016 Expression of arginase I and inducible nitric oxide synthase in the peripheral blood and lymph nodes of HIV?positive patients.
26571397 2015 Helminth-induced arginase-1 exacerbates lung inflammation and disease severity in tuberculosis.
26538654 2015 Sustained Arginase 1 Expression Modulates Pathological Tau Deposits in a Mouse Model of Tauopathy.
26227111 2015 High-level expression of human arginase I in Pichia pastoris and its immobilization on chitosan to produce L-ornithine.
26161395 2015 Expression of FOXP3, CD14, and ARG1 in Neuroblastoma Tumor Tissue from High-Risk Patients Predicts Event-Free and Overall Survival.
26126810 2015 Arginase inhibition protects against hypoxia?induced pulmonary arterial hypertension.
26119192 2015 Effect of Neutrophils on Nitric Oxide Production from Stimulated Macrophages.
26061397 2015 Elevated ARG1 expression in primary monocytes-derived macrophages as a predictor of radiation-induced acute skin toxicities in early breast cancer patients.
26030248 2015 HepPar-1 and Arginase-1 Immunohistochemistry in Adenocarcinoma of the Small Intestine and Ampullary Region.
25961062 2015 IL-10 and ARG-1 concentrations in bone marrow and peripheral blood of metastatic neuroblastoma patients do not associate with clinical outcome.
More...