Property Summary

Ligand Count 33
NCBI Gene PubMed Count 139
PubMed Score 593.23
PubTator Score 332.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Obesity 678 0.0 2.2
Disease Target Count Z-score Confidence
Cancer 2499 3.793 1.9
Spastic diplegia 5 3.587 1.8
Vascular disease 319 3.394 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -2.000 2.6e-02
lung adenocarcinoma -1.800 1.9e-13
mucosa-associated lymphoid tissue lympho... 2.847 2.7e-02
osteosarcoma -5.894 2.0e-06
periodontitis -1.600 2.4e-16
primitive neuroectodermal tumor -1.200 4.8e-04
psoriasis 2.200 1.4e-06

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (120)

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNP      1 - 70
RSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNL     71 - 140
HGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK    141 - 210
VMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP    211 - 280
SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK                                281 - 322
//

Text Mined References (144)

PMID Year Title