Property Summary

Ligand Count 387
NCBI Gene PubMed Count 2,333
PubMed Score 9853.31
PubTator Score 9905.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.1

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-03
atypical teratoid / rhabdoid tumor -1.300 3.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.222 7.1e-03
Breast cancer 2.400 3.3e-02
dermatomyositis 1.200 2.3e-02
ependymoma 1.200 2.3e-02
group 3 medulloblastoma -1.900 6.1e-04
head and neck cancer and chronic obstruc... -1.200 1.4e-02
juvenile dermatomyositis 1.384 6.8e-10
lung carcinoma 1.100 2.4e-15
medulloblastoma, large-cell -1.400 6.6e-03
oligodendroglioma 1.500 5.6e-03
osteosarcoma 1.462 1.0e-06
ovarian cancer -1.100 4.9e-03
Pick disease -1.100 2.2e-04
Polycystic ovary syndrome 1.120 5.0e-03
psoriasis -1.300 1.0e-03
Rheumatoid arthritis 1.200 4.4e-02

Synonym

Accession P05067 B2R5V1 B4DII8 D3DSD1 D3DSD2 D3DSD3 P09000 P78438 Q13764 Q13778 Q13793 Q16011 Q16014 Q16019 Q16020 Q6GSC0 Q8WZ99 Q9BT38 Q9UC33 Q9UCA9 Q9UCB6 Q9UCC8 Q9UCD1 Q9UQ58
Symbols AAA
AD1
PN2
ABPP
APPI
CVAP
ABETA
PN-II
preA4
CTFgamma

Gene

APP

PANTHER Protein Class (2)

PDB

2G47   2WK3   4M1C   1ZJD   4HIX   4XXD   3MXC   3MXY   3L33   5C67   5VZY   4NGE   5AM8   5AMB   3L81   4MDR   3AYU   3DXC   3DXD   3DXE   1AAP   1AMB   1AMC   1AML   1BA4   1BA6   1BJB   1BJC   1BRC   1CA0   1HZ3   1IYT   1MWP   1OWT   1QCM   1QWP   1QXC   1QYT   1TAW   1TKN   1UO7   1UO8   1UOA   1UOI   1X11   1Z0Q   1ZE7   1ZE9   2BEG   2BOM   2BP4   2FJZ   2FK1   2FK2   2FK3   2FKL   2FMA   2IPU   2LFM   2LLM   2LMN   2LMO   2LMP   2LMQ   2LNQ   2LOH   2LP1   2LZ3   2LZ4   2M4J   2M9R   2M9S   2MGT   2MJ1   2MPZ   2MVX   2MXU   2NAO   2OTK   2R0W   2Y29   2Y2A   2Y3J   2Y3K   2Y3L   3BAE   3BKJ   3GCI   3IFL   3IFN   3IFO   3IFP   3JQ5   3JQL   3JTI   3KTM   3MOQ   3NYJ   3NYL   3OVJ   3OW9   3PZZ   3Q2X   3SV1   3U0T   3UMH   3UMI   3UMK   4JFN   4MVI   4MVK   4MVL   4OJF   4ONF   4ONG   4PQD   4PWQ   5AEF   5BUO   5CSZ   5HOW   5HOX   5HOY   5KK3   5MY4   5MYO   5MYX   5OQV   5W3P  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (2063)

AA Sequence

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL      1 - 70
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER     71 - 140
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW    141 - 210
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT    211 - 280
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLL    281 - 350
KTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA    351 - 420
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHV    421 - 490
FNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD    491 - 560
EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVP    561 - 630
ANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKG    631 - 700
AIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN    701 - 770
//

Text Mined References (2347)

PMID Year Title