Property Summary

NCBI Gene PubMed Count 2,176
PubMed Score 4118.95
PubTator Score 9905.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
lung carcinoma 2844 2.39335930927326E-15
juvenile dermatomyositis 1189 6.84097627190797E-10
osteosarcoma 7933 1.04101245020827E-6
Pick disease 1893 2.22542226481199E-4
group 3 medulloblastoma 2254 6.08066419951223E-4
psoriasis 6685 0.00103255462852324
medulloblastoma, large-cell 6234 0.0012966016846295
ovarian cancer 8492 0.00266682623442901
atypical teratoid / rhabdoid tumor 4369 0.00378696886646618
astrocytic glioma 2241 0.00421254779568288
Polycystic Ovary Syndrome 335 0.00496552671802161
oligodendroglioma 2849 0.00558096593130458
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00708052446064597
head and neck cancer and chronic obstructive pulmonary disease 237 0.0138332370992351
dermatomyositis 967 0.0225268494273598
ependymoma 2514 0.0228944724541024
Breast cancer 3099 0.0326023883753026
Rheumatoid Arthritis 1171 0.0443840178379596
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 7.921 4.0
Disease Target Count
Alzheimer disease 1 1

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.044
astrocytic glioma -1.100 0.004
ependymoma 1.200 0.023
oligodendroglioma 1.500 0.006
psoriasis -1.300 0.001
osteosarcoma 1.462 0.000
atypical teratoid / rhabdoid tumor -1.300 0.004
medulloblastoma, large-cell -1.900 0.001
autosomal dominant Emery-Dreifuss muscul... 1.222 0.007
juvenile dermatomyositis 1.384 0.000
Breast cancer 2.400 0.033
group 3 medulloblastoma -1.900 0.001
Polycystic Ovary Syndrome 1.120 0.005
lung carcinoma 1.100 0.000
Pick disease -1.100 0.000
ovarian cancer 1.700 0.003
dermatomyositis 1.200 0.023
head and neck cancer and chronic obstruc... -1.200 0.014

Synonym

Gene

APP

PANTHER Protein Class (1)

PDB

2G47   2WK3   4M1C   1ZJD   4HIX   4XXD   3MXC   3MXY   3L33   5C67   4NGE   5AM8   5AMB   3L81   4MDR   3AYU   3DXC   3DXD   3DXE   1AAP   1AMB   1AMC   1AML   1BA4   1BA6   1BJB   1BJC   1BRC   1CA0   1HZ3   1IYT   1MWP   1OWT   1QCM   1QWP   1QXC   1QYT   1TAW   1TKN   1UO7   1UO8   1UOA   1UOI   1X11   1Z0Q   1ZE7   1ZE9   2BEG   2BOM   2BP4   2FJZ   2FK1   2FK2   2FK3   2FKL   2FMA   2IPU   2LFM   2LLM   2LMN   2LMO   2LMP   2LMQ   2LNQ   2LOH   2LP1   2LZ3   2LZ4   2M4J   2M9R   2M9S   2MGT   2MJ1   2MPZ   2MVX   2MXU   2NAO   2OTK   2R0W   2Y29   2Y2A   2Y3J   2Y3K   2Y3L   3BAE   3BKJ   3GCI   3IFL   3IFN   3IFO   3IFP   3JQ5   3JQL   3JTI   3KTM   3MOQ   3NYJ   3NYL   3OVJ   3OW9   3SV1   3U0T   3UMH   3UMI   3UMK   4JFN   4MVI   4MVK   4MVL   4OJF   4ONF   4ONG   4PQD   4PWQ   5AEF   5BUO   5CSZ   5HOW   5HOX   5HOY   5KK3  

  Ortholog (10)

Species Source
Chimp OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1276 screening 1987 / 0 / 191470 Primary screen for compounds that activate Alzheimer's amyloid precursor
1285 screening 1590 / 0 / 192181 Primary screen for compounds that inhibit Alzheimer's amyloid precursor protein (APP) translation
504929 other 2 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: Amplified proximity luminescence-based biochemical assay to identify inhibitors of residues 1-40 of amyloid beta

Gene RIF (1928)

PMID Text
27058954 evaluated Abeta-induced DNA methylation status of HMOX1 at -374 promoter CpG site in blood samples from Alzheimer disease patients, patients with mild cognitive impairment, and control individuals
27036734 These findings identify Syt1 as a novel Ca(2+)-sensitive PS1 modulator that could regulate synaptic ABETA, opening avenues for novel and selective synapse targeting therapeutic strategies.
27013020 The conformational dynamics of large fatty acids derived oligomers (Abeta42) correlates with their ability to replicate and to induce apoptosis in human neuroblastoma cells, with 12mers being more neurotoxic and prone to replication than 12-24mers.
26991731 Data suggest that light-chain subunits/fragments of kinesin-1 inhibit the pathological aggregation of amyloid(beta).
26983928 Data suggest that amyloid beta peptide fragments associated with Alzheimer disease [Abeta(16-22) and Abeta(11-25)] exhibit high degree of polymorphism in forming hydrogen-bonded networks.
26948379 Sporadic Abeta accumulation may be partly associated with increased amyloidogenic APP production, especially in APOE varepsilon4-negative subjects.
26919121 The monomer to oligomer transition and the radius of gyration were studied using SANS. A hydrodynamic radius of 1.8+/-0.3 nm was found for Abeta1-40 and 3.2+/-0.4 nm for Abeta1-42 including a surface layer of dHFIP solvent molecules.
26907684 data show that p-FTAA promoted the formation of insoluble and stable Abeta species that were nontoxic which indicates that p-FTAA might have therapeutic potential.
26876913 Bipolar disorder-mild cognitive impairment patients had a non-significant reduction in CSF Abeta1-42 compared to controls, but this was still higher than in the Alzheimer disease group.
26865619 we found Abeta-related increases in frontoparietal control regions compared with baseline activity
More...

AA Sequence

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL      1 - 70
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER     71 - 140
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW    141 - 210
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT    211 - 280
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLL    281 - 350
KTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA    351 - 420
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHV    421 - 490
FNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD    491 - 560
EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVP    561 - 630
ANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKG    631 - 700
AIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN    701 - 770
//

Text Mined References (2191)

PMID Year Title
27058954 2016 Amyloid Beta-Mediated Hypomethylation of Heme Oxygenase 1 Correlates with Cognitive Impairment in Alzheimer's Disease.
27036734 2016 Identification of the novel activity-driven interaction between synaptotagmin 1 and presenilin 1 links calcium, synapse, and amyloid beta.
27013020 2016 Conformational Dynamics of Specific A? Oligomers Govern Their Ability To Replicate and Induce Neuronal Apoptosis.
26991731 2016 Kinesin-1 inhibits the aggregation of amyloid-? peptide as detected by fluorescence cross-correlation spectroscopy.
26983928 2016 Amyloid Hydrogen Bonding Polymorphism Evaluated by (15)N{(17)O}REAPDOR Solid-State NMR and Ultra-High Resolution Fourier Transform Ion Cyclotron Resonance Mass Spectrometry.
26948379 2016 Increased amyloidogenic APP processing in APOE ?4-negative individuals with cerebral ?-amyloidosis.
26919121 2016 Monomeric Amyloid Beta Peptide in Hexafluoroisopropanol Detected by Small Angle Neutron Scattering.
26907684 2016 The Luminescent Oligothiophene p-FTAA Converts Toxic A?1-42 Species into Nontoxic Amyloid Fibers with Altered Properties.
26876913 2016 Cognitive impairment in late-life bipolar disorder is not associated with Alzheimer's disease pathological signature in the cerebrospinal fluid.
26865619 2016 ?-Amyloid Deposition Is Associated with Decreased Right Prefrontal Activation during Task Switching among Cognitively Normal Elderly.
More...