Property Summary

NCBI Gene PubMed Count 56
Grant Count 13
R01 Count 10
Funding $811,393.75
PubMed Score 432.96
PubTator Score 35.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (24)

PMID Text
26376879 The downregulation of ALDOB could indicate a poor prognosis for HCC patients, and therefore, ALDOB might be considered a prognostic biomarker for HCC, especially at the early stage.
25352737 Single nucleotide polymorphisms in ALDOB, MAP3K1, and MEF2C are associated with cataract.
25072145 both of exogenous and endogenous ALDOB proteins bind to hepatitis B surface antigen and colocalize in the cytoplasm in vitro and inhibit apoptosis of cisplatin-induced HepG2 cells.
24993527 ALDOC, Aldolase A (ALDOA) and Aldolase B (ALDOB) activate Wnt signaling.
22911800 Efficient inhibition of aldolase B can prevent high glucose-induced overproduction of methylglyoxal and related cellular dysfunction in endothelial cells.
21166391 Aldolase B with the A149P substitution has activity that is <100-fold that of the wild type.
20882353 These novel mutations in ALDOB represent 2% of alleles in American HFI (hereditary fructose intolerance) patients, with IVS1+1G>C representing a significantly higher allele frequency (6%) among HFI patients of Hispanic and African-American ethnicity.
20848650 This is the first report of six unrelated patients sharing the same ALDOB deletion, thus indicating a founder effect for this allele.
20162364 Biochemical study of defective aldolase B enzymes is key to revealing the molecular basis of the disease and providing a stronger basis for improved treatment and diagnosis
20033295 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSI      1 - 70
NQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKK     71 - 140
DGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVL    141 - 210
AAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDA    211 - 280
TLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSG    281 - 350
AASTQSLFTACYTY                                                            351 - 364
//

Text Mined References (57)

PMID Year Title
26376879 2015 Aldolase B inhibits metastasis through Ten-Eleven Translocation 1 and serves as a prognostic biomarker in hepatocellular carcinoma.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
25072145 2014 ALDOB acts as a novel HBsAg-binding protein and its coexistence inhibits cisplatin-induced HepG2 cell apoptosis.
24993527 2014 Aldolase positively regulates of the canonical Wnt signaling pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22911800 2012 Aldolase B knockdown prevents high glucose-induced methylglyoxal overproduction and cellular dysfunction in endothelial cells.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21166391 2011 Stabilization of the predominant disease-causing aldolase variant (A149P) with zwitterionic osmolytes.
More...