Property Summary

NCBI Gene PubMed Count 57
PubMed Score 442.09
PubTator Score 35.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
fructose-1,6-bisphosphatase deficiency 7 5.949 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 2.235 2.1e-02
active ulcerative colitis 3.430 4.7e-03
colon cancer 2.500 4.3e-02
intraductal papillary-mucinous carcinoma... 1.600 4.1e-02
intraductal papillary-mucinous neoplasm ... 1.600 9.3e-03
lung cancer -1.100 2.2e-02
nephrosclerosis -2.426 2.7e-02
pituitary cancer -1.200 3.1e-03

Protein-protein Interaction (3)

Gene RIF (25)

AA Sequence

MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSI      1 - 70
NQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKK     71 - 140
DGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVL    141 - 210
AAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDA    211 - 280
TLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSG    281 - 350
AASTQSLFTACYTY                                                            351 - 364
//

Text Mined References (58)

PMID Year Title