Property Summary

NCBI Gene PubMed Count 54
Grant Count 17
R01 Count 5
Funding $1,221,698.79
PubMed Score 135.58
PubTator Score 141.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26152395 intracellular calcium binding protein Sg1 is increased in early multiple sclerosis (MS) patients compared to relapsing-remitting MS and neurological controls.
26003296 The polymorphism P413L in the CHGB gene was not associated with sporadic amyotrophic lateral sclerosis in a group of Italian patients.
23939195 CgA and CgB have been used as general NEN biomarkers for many years, while CART has only recently been identified
23816467 A heterogeneous response to short- and long-term physical activities among circulating granin proteins, particularly chromogranin B.
23423580 CgA, CgB, and secretoneurin are detectable in feces, and collagenous colitis patients express higher values than patients with inflammatory bowel disease and controls. In treatment, fecal secretoneurin decreased to control levels in collagenous colitis.
23361940 Our findings suggest that altered PTEN, ATRX, CHGA, and CHGB expression are associated with aggressive PNET phenotype in VHL and may serve as useful adjunct prognostic markers to Ki-67 in PNETs.
21046455 The roles of Cgs A and B in maintaining the intravesicular environment of secretory vesicles and in exocytosis, bringing together the most recent findings from adrenal chromaffin cells, are discussed.
21046454 This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III.
20932227 Results do not support the 413L variant of chromogranin B as a risk factor for sporadic amyotrophic lateral sclerosis in the French population.
20932227 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKD      1 - 70
KETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWS     71 - 140
LYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKK    141 - 210
EELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTR    211 - 280
PRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPG    281 - 350
VQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHR    351 - 420
GRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQ    421 - 490
DTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEK    491 - 560
NFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPV    561 - 630
STHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG                           631 - 677
//

Text Mined References (58)

PMID Year Title
26152395 2015 Quantitative proteomics suggests decrease in the secretogranin-1 cerebrospinal fluid levels during the disease course of multiple sclerosis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26003296 2015 Lack of relationship between the P413L chromogranin B variant and a SALS Italian cohort.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23939195 2014 The biochemical utility of chromogranin A, chromogranin B and cocaine- and amphetamine-regulated transcript for neuroendocrine neoplasia.
23816467 2013 Effect of short- and long-term physical activities on circulating granin protein levels.
23423580 2013 Increased fecal levels of chromogranin A, chromogranin B, and secretoneurin in collagenous colitis.
23361940 2013 Altered PTEN, ATRX, CHGA, CHGB, and TP53 expression are associated with aggressive VHL-associated pancreatic neuroendocrine tumors.
More...