Property Summary

NCBI Gene PubMed Count 58
PubMed Score 139.31
PubTator Score 141.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 3.232 3.9e-06
adrenocortical adenoma -1.490 9.2e-03
adult high grade glioma -2.900 1.9e-04
aldosterone-producing adenoma -2.663 2.1e-02
astrocytic glioma -2.400 3.5e-03
Astrocytoma, Pilocytic -2.200 9.7e-06
atypical teratoid / rhabdoid tumor -4.200 7.0e-06
colon cancer -2.700 1.8e-05
Down syndrome -1.500 2.2e-02
ependymoma -3.200 4.8e-02
glioblastoma -2.900 3.6e-07
group 4 medulloblastoma 1.400 1.9e-02
intraductal papillary-mucinous adenoma (... -3.500 2.0e-03
intraductal papillary-mucinous carcinoma... -3.700 2.0e-03
intraductal papillary-mucinous neoplasm ... -3.100 4.7e-02
lung cancer 2.600 1.4e-04
lung carcinoma 5.800 6.0e-59
malignant mesothelioma -1.300 6.3e-05
oligodendroglioma -1.100 2.2e-03
ovarian cancer -3.400 1.1e-16
permanent atrial fibrillation 1.200 5.7e-06
Pick disease -1.700 5.9e-03
subependymal giant cell astrocytoma -2.594 4.0e-02

Gene RIF (37)

AA Sequence

MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKD      1 - 70
KETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWS     71 - 140
LYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKK    141 - 210
EELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTR    211 - 280
PRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPG    281 - 350
VQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHR    351 - 420
GRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQ    421 - 490
DTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEK    491 - 560
NFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPV    561 - 630
STHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG                           631 - 677
//

Text Mined References (62)

PMID Year Title