Property Summary

NCBI Gene PubMed Count 73
Grant Count 5
R01 Count 4
Funding $392,159
PubMed Score 18.95
PubTator Score 308.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
26286140 Na,K-ATPase b1-subunit is a target of the Shh signaling pathway and loss of b1-subunit expression may contribute to tumor development and progression not only in carcinoma but also in medulloblastoma, a tumor of neuronal origin.
25152327 Impaired regulation and compromised activity of ion channel proteins contribute to the pathophysiology of vascular dementia.
25012180 Activities of AE1 and the sodium pump are coregulated in kidney.
24452105 ATP1B1 is epigenetically silenced by promoter methylation in both renal cell carcinoma (RCC) patients' tissues and cell lines.
24098465 A polymorphic 3'UTR element in ATP1B1 regulates alternative polyadenylation and is associated with blood pressure.
23048038 NRF-1 regulates Atp1a1 and Atp1b1 and are important in mediating the energy generation and neuronal activity.
23009595 Changes were found in mRNA and protein expressions of Na(+)/K(+)-ATPase subunits in LG from term pregnant rabbits and these changes suggest a role in the pregnancy-related LG secretion changes and dry eye symptoms observed in these animals.
22433860 Data show that protein kinase A (PKA) phosphorylation has a drastic impact on Na(+)/K(+)-ATPase (NKA) structure and dynamics
21881522 examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans
21642423 interactions between the beta subunits of neighboring cells maintain integrity of intercellular junctions
More...

AA Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD      1 - 70
RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFN     71 - 140
HERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP    141 - 210
VQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYG    211 - 280
ENIGYSEKDRFQGRFDVKIEVKS                                                   281 - 303
//

Text Mined References (78)

PMID Year Title
26286140 2015 Na,K-ATPase ?1-subunit is a target of sonic hedgehog signaling and enhances medulloblastoma tumorigenicity.
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25152327 2014 iTRAQ quantitative clinical proteomics revealed role of Na(+)K(+)-ATPase and its correlation with deamidation in vascular dementia.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
25012180 2015 Physical and functional links between anion exchanger-1 and sodium pump.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24452105 2014 Epigenetic silencing of Na,K-ATPase ? 1 subunit gene ATP1B1 by methylation in clear cell renal cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...