| Tclin | Sodium/potassium-transporting ATPase subunit beta-1 |
Involved in cell adhesion and establishing epithelial cell polarity.
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]
Comments
Property Summary
| NCBI Gene PubMed Count | 73 |
| Grant Count | 5 |
| R01 Count | 4 |
| Funding | $392,159 |
| PubMed Score | 18.95 |
| PubTator Score | 308.62 |
| Disease | log2 FC | p |
|---|---|---|
| hepatocellular carcinoma | -1.100 | 0.029 |
| Waldenstrons macroglobulinemia | 1.891 | 0.013 |
| Multiple myeloma | 2.216 | 0.025 |
| psoriasis | 1.100 | 0.044 |
| astrocytoma | -1.900 | 0.021 |
| glioblastoma | -2.600 | 0.000 |
| oligodendroglioma | -1.800 | 0.000 |
| osteosarcoma | 2.879 | 0.000 |
| sonic hedgehog group medulloblastoma | -2.400 | 0.000 |
| atypical teratoid / rhabdoid tumor | -2.500 | 0.000 |
| medulloblastoma, large-cell | -2.500 | 0.000 |
| primitive neuroectodermal tumor | -1.400 | 0.004 |
| intraductal papillary-mucinous adenoma (... | 1.400 | 0.002 |
| intraductal papillary-mucinous carcinoma... | 1.400 | 0.002 |
| intraductal papillary-mucinous neoplasm ... | 1.800 | 0.004 |
| Parkinson's disease | -1.200 | 0.027 |
| fibroadenoma | 1.400 | 0.048 |
| Breast cancer | 2.400 | 0.030 |
| interstitial cystitis | -1.100 | 0.013 |
| pediatric high grade glioma | -2.200 | 0.000 |
| pilocytic astrocytoma | -2.200 | 0.000 |
| lung adenocarcinoma | 1.344 | 0.037 |
| ductal carcinoma in situ | 1.400 | 0.037 |
| invasive ductal carcinoma | 1.500 | 0.047 |
| ovarian cancer | 2.700 | 0.000 |
| PMID | Text |
|---|---|
| 26286140 | Na,K-ATPase b1-subunit is a target of the Shh signaling pathway and loss of b1-subunit expression may contribute to tumor development and progression not only in carcinoma but also in medulloblastoma, a tumor of neuronal origin. |
| 25152327 | Impaired regulation and compromised activity of ion channel proteins contribute to the pathophysiology of vascular dementia. |
| 25012180 | Activities of AE1 and the sodium pump are coregulated in kidney. |
| 24452105 | ATP1B1 is epigenetically silenced by promoter methylation in both renal cell carcinoma (RCC) patients' tissues and cell lines. |
| 24098465 | A polymorphic 3'UTR element in ATP1B1 regulates alternative polyadenylation and is associated with blood pressure. |
| 23048038 | NRF-1 regulates Atp1a1 and Atp1b1 and are important in mediating the energy generation and neuronal activity. |
| 23009595 | Changes were found in mRNA and protein expressions of Na(+)/K(+)-ATPase subunits in LG from term pregnant rabbits and these changes suggest a role in the pregnancy-related LG secretion changes and dry eye symptoms observed in these animals. |
| 22433860 | Data show that protein kinase A (PKA) phosphorylation has a drastic impact on Na(+)/K(+)-ATPase (NKA) structure and dynamics |
| 21881522 | examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans |
| 21642423 | interactions between the beta subunits of neighboring cells maintain integrity of intercellular junctions |
| More... |
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD 1 - 70 RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFN 71 - 140 HERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP 141 - 210 VQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYG 211 - 280 ENIGYSEKDRFQGRFDVKIEVKS 281 - 303 //
| PMID | Year | Title |
|---|---|---|
| 26286140 | 2015 | Na,K-ATPase ?1-subunit is a target of sonic hedgehog signaling and enhances medulloblastoma tumorigenicity. |
| 25902260 | 2015 | Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. |
| 25240745 | 2014 | A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels. |
| 25152327 | 2014 | iTRAQ quantitative clinical proteomics revealed role of Na(+)K(+)-ATPase and its correlation with deamidation in vascular dementia. |
| 25055868 | 2014 | Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations. |
| 25012180 | 2015 | Physical and functional links between anion exchanger-1 and sodium pump. |
| 24952745 | 2014 | Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization. |
| 24769233 | 2014 | Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset. |
| 24452105 | 2014 | Epigenetic silencing of Na,K-ATPase ? 1 subunit gene ATP1B1 by methylation in clear cell renal cell carcinoma. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| More... |
