Tclin | Sodium/potassium-transporting ATPase subunit beta-1 |
Involved in cell adhesion and establishing epithelial cell polarity.
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Essential Hypertension | 94 | 0.0 | 0.0 |
Leukemia, Myeloid, Acute | 105 | 0.0 | 0.0 |
Substance-Related Disorders | 115 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Leukemia, Myelocytic, Acute | 120 |
Disease | Target Count |
---|---|
Atrial Fibrillation | 124 |
Chronic heart failure | 46 |
Congestive heart failure | 113 |
Poisoning by digitalis glycoside | 8 |
Disease | Target Count | P-value |
---|---|---|
oligodendroglioma | 2850 | 2.3e-12 |
astrocytoma | 1146 | 2.8e-12 |
Astrocytoma, Pilocytic | 3081 | 4.2e-08 |
glioblastoma | 5792 | 3.6e-07 |
group 3 medulloblastoma | 4104 | 1.8e-05 |
osteosarcoma | 7950 | 8.1e-05 |
medulloblastoma, large-cell | 6241 | 1.3e-04 |
ovarian cancer | 8520 | 7.4e-04 |
adult high grade glioma | 3801 | 9.1e-04 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.1e-03 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 2.2e-03 |
atypical teratoid / rhabdoid tumor | 5112 | 3.0e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 4.4e-03 |
interstitial cystitis | 2312 | 1.3e-02 |
Waldenstrons macroglobulinemia | 765 | 1.3e-02 |
Multiple myeloma | 1332 | 2.5e-02 |
Parkinson's disease | 392 | 2.7e-02 |
hepatocellular carcinoma | 547 | 2.9e-02 |
Breast cancer | 3578 | 3.0e-02 |
primitive neuroectodermal tumor | 3035 | 3.1e-02 |
lung adenocarcinoma | 2716 | 3.7e-02 |
ductal carcinoma in situ | 1745 | 3.7e-02 |
psoriasis | 6694 | 4.4e-02 |
invasive ductal carcinoma | 2951 | 4.7e-02 |
fibroadenoma | 559 | 4.8e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Heart conduction disease | 83 | 0.0 | 3.0 |
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | -1.300 | 9.1e-04 |
astrocytoma | -1.500 | 2.8e-12 |
Astrocytoma, Pilocytic | -2.200 | 4.2e-08 |
atypical teratoid / rhabdoid tumor | -2.400 | 3.0e-03 |
Breast cancer | 2.400 | 3.0e-02 |
ductal carcinoma in situ | 1.400 | 3.7e-02 |
fibroadenoma | 1.400 | 4.8e-02 |
glioblastoma | -2.000 | 3.6e-07 |
group 3 medulloblastoma | -2.300 | 1.8e-05 |
hepatocellular carcinoma | -1.100 | 2.9e-02 |
interstitial cystitis | -1.100 | 1.3e-02 |
intraductal papillary-mucinous adenoma (... | 1.400 | 2.2e-03 |
intraductal papillary-mucinous carcinoma... | 1.400 | 2.1e-03 |
intraductal papillary-mucinous neoplasm ... | 1.800 | 4.4e-03 |
invasive ductal carcinoma | 1.500 | 4.7e-02 |
lung adenocarcinoma | 1.344 | 3.7e-02 |
medulloblastoma, large-cell | -2.400 | 1.3e-04 |
Multiple myeloma | 2.216 | 2.5e-02 |
oligodendroglioma | -1.800 | 2.3e-12 |
osteosarcoma | 2.879 | 8.1e-05 |
ovarian cancer | -1.900 | 7.4e-04 |
Parkinson's disease | -1.200 | 2.7e-02 |
primitive neuroectodermal tumor | -1.300 | 3.1e-02 |
psoriasis | 1.100 | 4.4e-02 |
Waldenstrons macroglobulinemia | 1.891 | 1.3e-02 |
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD 1 - 70 RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFN 71 - 140 HERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP 141 - 210 VQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYG 211 - 280 ENIGYSEKDRFQGRFDVKIEVKS 281 - 303 //