Property Summary

Ligand Count 7
NCBI Gene PubMed Count 136
PubMed Score 43.16
PubTator Score 111.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 1.5e-03
astrocytic glioma -1.100 4.6e-03
atypical teratoid / rhabdoid tumor -1.800 3.1e-06
diabetes mellitus -1.200 9.7e-03
Duchenne muscular dystrophy 1.161 1.7e-10
ependymoma -1.100 2.9e-07
glioblastoma -1.200 1.5e-02
group 3 medulloblastoma -1.200 1.4e-02
juvenile dermatomyositis 1.145 2.3e-09
limb girdle muscular dystrophy 2B 1.071 6.1e-05
lung cancer 1.200 2.6e-03
medulloblastoma, large-cell -2.600 1.3e-05
ovarian cancer 2.100 5.6e-05
Pick disease -1.100 1.8e-03
primitive neuroectodermal tumor -1.900 4.4e-05
subependymal giant cell astrocytoma -1.372 2.1e-02

Gene RIF (84)

AA Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE      1 - 70
ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV     71 - 140
IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG    141 - 210
CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG    211 - 280
QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR    281 - 350
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA    351 - 420
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL    421 - 490
SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL    491 - 560
PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG    561 - 630
VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI    631 - 700
IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD    701 - 770
NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK    771 - 840
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ    841 - 910
RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM    911 - 980
YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY                               981 - 1023
//

Text Mined References (145)

PMID Year Title