Property Summary

NCBI Gene PubMed Count 128
Grant Count 8
Funding $388,885.67
PubMed Score 33.10
PubTator Score 111.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.100 0.005
ependymoma -1.100 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.200 0.015
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.900 0.000
Duchenne muscular dystrophy 1.161 0.000
juvenile dermatomyositis 1.145 0.000
limb girdle muscular dystrophy 2B 1.071 0.000
lung cancer 1.200 0.003
diabetes mellitus -1.200 0.010
adult high grade glioma -1.200 0.001
subependymal giant cell astrocytoma -1.372 0.021
Pick disease -1.100 0.002
ovarian cancer 2.100 0.000

Gene RIF (80)

PMID Text
26446917 Our current findings demonstrate that Arctigenin is an antagonist of MR and effectively decreases the Na/K-ATPase 1 gene expression. Our work provides a hint for the drug discovery against cardiovascular disease
26418325 Mutations of the ATP1A1 depolarize adrenocortical cells, disturb the K+ sensitivity, and lower intracellular pH but do not induce an overt increase of intracellular Ca2+.
26351028 Different mutations (KCNJ5, ATP1A1, ATP2B3, and CACNA1D) are found in different aldosterone-producing nodules from the same adrenal, suggesting that somatic mutations are independent events triggered by mechanisms that remain to be identified.
26334094 Data suggest that targeting Na(+)/K(+) ATPase alpha-1 subunit (ATP1A1) is a approach to the treatment of hepatocellular carcinoma (HCC).
26285814 Mutations in ATP1A1 gene is associated with aldosterone-producing adenomas.
26158764 Gal-3 interacts with ATP1A1 and induces the phosphorylation of MDR1, mediating multidrug resistance.
25994790 Report tumor cell sensitivity to cardiac glycosides depends on pattern of expression of alpha1-, alpha2-, or alpha3-isoforms of Na-K-ATPase.
25791351 Studies indicate specific lipid-binding sites in Na,K-ATPase E1 and E2 crystal structures.
25653449 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
25631074 Cellular biotinylated ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1) protein is incorporated into HIV-1 Gag virus-like particles
More...

AA Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE      1 - 70
ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV     71 - 140
IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG    141 - 210
CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG    211 - 280
QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR    281 - 350
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA    351 - 420
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL    421 - 490
SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL    491 - 560
PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG    561 - 630
VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI    631 - 700
IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD    701 - 770
NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK    771 - 840
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ    841 - 910
RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM    911 - 980
YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY                               981 - 1023
//

Text Mined References (136)

PMID Year Title
26446917 2016 Arctigenin antagonizes mineralocorticoid receptor to inhibit the transcription of Na/K-ATPase.
26418325 2015 Pathogenesis of Adrenal Aldosterone-Producing Adenomas Carrying Mutations of the Na(+)/K(+)-ATPase.
26351028 2015 Different Somatic Mutations in Multinodular Adrenals With Aldosterone-Producing Adenoma.
26334094 2015 Na+/K+-ATPase ?1 subunit, a novel therapeutic target for hepatocellular carcinoma.
26285814 2015 Novel somatic mutations and distinct molecular signature in aldosterone-producing adenomas.
26158764 2015 Extracellular galectin-3 programs multidrug resistance through Na+/K+-ATPase and P-glycoprotein signaling.
25994790 2015 Cardiac glycosides induced toxicity in human cells expressing ?1-, ?2-, or ?3-isoforms of Na-K-ATPase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25791351 2015 General and specific lipid-protein interactions in Na,K-ATPase.
25653449 2015 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
More...