Property Summary

NCBI Gene PubMed Count 128
PubMed Score 33.10
PubTator Score 111.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.100 0.005
ependymoma -1.100 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.200 0.015
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.900 0.000
Duchenne muscular dystrophy 1.161 0.000
juvenile dermatomyositis 1.145 0.000
limb girdle muscular dystrophy 2B 1.071 0.000
lung cancer 1.200 0.003
diabetes mellitus -1.200 0.010
adult high grade glioma -1.200 0.001
subependymal giant cell astrocytoma -1.372 0.021
Pick disease -1.100 0.002
ovarian cancer 2.100 0.000

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (77)

PMID Text
26446917 Our current findings demonstrate that Arctigenin is an antagonist of MR and effectively decreases the Na/K-ATPase 1 gene expression. Our work provides a hint for the drug discovery against cardiovascular disease
26418325 Mutations of the ATP1A1 depolarize adrenocortical cells, disturb the K+ sensitivity, and lower intracellular pH but do not induce an overt increase of intracellular Ca2+.
26351028 Different mutations (KCNJ5, ATP1A1, ATP2B3, and CACNA1D) are found in different aldosterone-producing nodules from the same adrenal, suggesting that somatic mutations are independent events triggered by mechanisms that remain to be identified.
26334094 Data suggest that targeting Na(+)/K(+) ATPase alpha-1 subunit (ATP1A1) is a approach to the treatment of hepatocellular carcinoma (HCC).
26285814 Mutations in ATP1A1 gene is associated with aldosterone-producing adenomas.
26158764 Gal-3 interacts with ATP1A1 and induces the phosphorylation of MDR1, mediating multidrug resistance.
25994790 Report tumor cell sensitivity to cardiac glycosides depends on pattern of expression of alpha1-, alpha2-, or alpha3-isoforms of Na-K-ATPase.
25791351 Studies indicate specific lipid-binding sites in Na,K-ATPase E1 and E2 crystal structures.
25653449 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
25631074 Cellular biotinylated ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1) protein is incorporated into HIV-1 Gag virus-like particles
More...

AA Sequence

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE      1 - 70
ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV     71 - 140
IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG    141 - 210
CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG    211 - 280
QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR    281 - 350
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA    351 - 420
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL    421 - 490
SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL    491 - 560
PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG    561 - 630
VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI    631 - 700
IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD    701 - 770
NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK    771 - 840
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ    841 - 910
RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM    911 - 980
YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY                               981 - 1023
//

Text Mined References (136)

PMID Year Title
26446917 2016 Arctigenin antagonizes mineralocorticoid receptor to inhibit the transcription of Na/K-ATPase.
26418325 2015 Pathogenesis of Adrenal Aldosterone-Producing Adenomas Carrying Mutations of the Na(+)/K(+)-ATPase.
26351028 2015 Different Somatic Mutations in Multinodular Adrenals With Aldosterone-Producing Adenoma.
26334094 2015 Na+/K+-ATPase ?1 subunit, a novel therapeutic target for hepatocellular carcinoma.
26285814 2015 Novel somatic mutations and distinct molecular signature in aldosterone-producing adenomas.
26158764 2015 Extracellular galectin-3 programs multidrug resistance through Na+/K+-ATPase and P-glycoprotein signaling.
25994790 2015 Cardiac glycosides induced toxicity in human cells expressing ?1-, ?2-, or ?3-isoforms of Na-K-ATPase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25791351 2015 General and specific lipid-protein interactions in Na,K-ATPase.
25653449 2015 ATP1A1-mediated Src signaling inhibits coronavirus entry into host cells.
More...