Property Summary

NCBI Gene PubMed Count 1,481
PubMed Score 21900.25
PubTator Score 13414.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 2.98653381261204E-8
Duchenne muscular dystrophy 602 5.92242649581778E-6
breast carcinoma 1614 1.22939408988997E-5
juvenile dermatomyositis 1189 1.71168898442447E-5
lung cancer 4473 2.27865131437286E-5
invasive ductal carcinoma 2950 1.0470120298677E-4
malignant mesothelioma 3163 1.16543403991163E-4
adrenocortical carcinoma 1427 1.54671698022728E-4
interstitial cystitis 2299 2.64308184160001E-4
ependymoma 2514 4.91521837854816E-4
primary Sjogren syndrome 789 5.45455410624024E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.29329481402394E-4
oligodendroglioma 2849 0.00109428252102038
ovarian cancer 8492 0.00269877650154757
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00521074780938473
group 4 medulloblastoma 1875 0.00524611501906379
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00545910285115091
Atopic dermatitis 944 0.00857955041098174
Amyotrophic Lateral Sclerosis 432 0.00942916550590687
pediatric high grade glioma 2712 0.00965170514118613
ductal carcinoma in situ 1745 0.0118590894696441
psoriasis 6685 0.0133016714012486
limb girdle muscular dystrophy 2A 156 0.0196165330404847
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0212015149208474
acute quadriplegic myopathy 1157 0.0224842575423921
glioblastoma 5572 0.025267737354326
Breast cancer 3099 0.0259889637897627
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.029066329000115
astrocytic glioma 2241 0.0326746468296239
Disease Target Count Z-score Confidence
Cancer 2346 6.377 3.2
diabetes mellitus 1663 6.173 3.1
Laron syndrome 9 6.112 3.1
Hypopituitarism 36 6.102 3.1
Obesity 616 5.681 2.8
Osteoporosis 259 5.615 2.8
Pituitary adenoma 35 5.61 2.8
Hypogonadism 70 5.509 2.8
Hyperinsulinism 63 5.303 2.7
Anorexia nervosa 59 5.217 2.6
Hypoglycemia 81 5.169 2.6
Hyperglycemia 120 5.034 2.5
Kidney disease 397 4.985 2.5
Polycystic Ovary Syndrome 335 4.822 2.4
Hypothyroidism 89 4.74 2.4
Myopathy 128 4.714 2.4
Retinopathy of prematurity 21 4.64 2.3
Hypertension 293 4.552 2.3
Hyperprolactinemia 22 4.515 2.3
Neurodegenerative disease 383 4.515 2.3
Metabolic syndrome X 155 4.397 2.2
Osteoarthritis 96 4.325 2.2
Donohue Syndrome 6 4.294 2.1
Heart disease 279 4.266 2.1
Prader-Willi syndrome 45 4.244 2.1
Diabetic Retinopathy 53 4.182 2.1
Liver disease 219 4.112 2.1
Amenorrhea 60 4.04 2.0
Hyperandrogenism 32 4.009 2.0
Coronary artery disease 240 3.919 2.0
Atherosclerosis 275 3.914 2.0
Craniopharyngioma 13 3.879 1.9
Hyperthyroidism 50 3.797 1.9
Goiter 27 3.738 1.9
Cerebrovascular disease 231 3.682 1.8
Short bowel syndrome 16 3.591 1.8
Cushing's syndrome 47 3.585 1.8
Metabolic acidosis 49 3.577 1.8
McCune Albright syndrome 19 3.572 1.8
Infertility 163 3.558 1.8
protein-energy malnutrition 8 3.476 1.7
Klinefelter's syndrome 59 3.474 1.7
Sleep apnea 8 3.449 1.7
Anovulation 20 3.261 1.6
Brain disease 84 3.243 1.6
Neuropathy 210 3.236 1.6
Lung disease 136 3.233 1.6
Hyperparathyroidism 43 3.219 1.6
Inflammatory bowel disease 142 3.219 1.6
Lipid metabolism disorder 102 3.209 1.6
Skin disease 65 3.195 1.6
Keratopathy 12 3.186 1.6
Silver-Russell syndrome 37 3.163 1.6
Graves' disease 25 3.127 1.6
Diffuse idiopathic skeletal hyperostosis 6 3.108 1.6
Dementia 129 3.007 1.5

Expression

See source...

Synonym

Accession P05019 B2RWM7 E9PD02 P01343 Q14620 IGF-I
Symbols MGF
IGFI
IGF-I

Gene

PANTHER Protein Class (2)

PDB

1H59   4XSS   1WQJ   2DSP   2DSQ   2DSR   1B9G   1BQT   1GF1   1GZR   1GZY   1GZZ   1H02   1IMX   1PMX   1TGR   2GF1   3GF1   3LRI  

  Ortholog (12)

Gene RIF (1479)

PMID Text
27214983 The established relationships suggests that the decrease of IGF-1 may represent the presence of syndromes of cytolysis and cholestasis in patients with NAFLD, type 2 DM and obesity.
26995937 We found differences in the relative expression of IGF-1A isoforms between the investigated groups.
26992254 Biliary levels of IGF-1 significantly increase in malignant biliary obstructions.
26991004 Full-length MGF directly stimulates the IGF-IR. Despite a higher EC50 concentration, at high equimolar concentrations full-length MGF showed a similar maximal potency to activate the IGF-IR as compared to IGF-I.
26976992 Study shows that IGF-I is overexpressed in patients with well-differentiated epithelial ovarian cancer.
26967642 Results show that elevated IGF-1 in serum might differentiate between patients in moderate Parkinson's Disease (PD) stages and controls. However, the value of serum IGF-1 as a trait-, progression- and prediction marker in PD is limited as IGF-1 showed large inter- and intraindividual variability and may be modulated by several confounders.
26953888 miR-130b-3p was downregulated in IPF lungs. miR-130b-3p downregulation contributed to the activation of fibroblasts and the dysregulated epithelial-mesenchymal crosstalk by promoting IGF-1 secretion from lung epithelium.
26925746 no clinical significance of serum levels in ovarian cancer
26902691 Metformin resulted in a significant reduction of IGF-1, IGF-1: IGFBP-3 molar ratio, insulin, FBG and HOMA-IR. On the other hand, metformin caused a significant increase of IGFBP-3.
26893016 Higher IGF-I levels among postmenopausal women and an elevated IGF-I:IGFBP-3 ratio among all women were associated with higher TDLU counts ; these associations were strongest among women with elevated mammographic density
More...

AA Sequence

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRG      1 - 70
FYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPST     71 - 140
NKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK                   141 - 195
//

Text Mined References (1486)

PMID Year Title
27214983 2015 [INSULIN-LIKE GROWTH FACTOR-1: THE INFLUENCE ON THE LIVER FUNCTION AND RELATIONSHIPS WITH RESISTIN IN PATIENTS WITH NONALCOHOLIC FATTY LIVER DISEASE AND ITS COMBINATION WITH TYPE 2 DIABETES MELLITUS].
26995937 2015 Insulin-like growth factor-1 isoforms in human ovary. Preliminary report on the expression of the IGF-1 gene in PCOS patients and healthy controls.
26992254 2016 Insulin-Like Growth Factor-1 and Vascular Endothelial Growth Factor in Malignant and Benign Biliary Obstructions.
26991004 2016 Potency of Full-Length MGF to Induce Maximal Activation of the IGF-I R Is Similar to Recombinant Human IGF-I at High Equimolar Concentrations.
26976992 2016 Role of IGF-I in Primary Ovarian Cancer - A Study of the OVCAD European Consortium.
26967642 2016 Insulin-Like Growth Factor 1 (IGF-1) in Parkinson's Disease: Potential as Trait-, Progression- and Prediction Marker and Confounding Factors.
26953888 2016 miR-130b-3p Modulates Epithelial-Mesenchymal Crosstalk in Lung Fibrosis by Targeting IGF-1.
26925746 2016 Significance of serum c-erbB-2 oncoprotein, insulin-like growth factor-1 and vascular endothelial growth factor levels in ovarian cancer.
26902691 2016 Metformin may protect nondiabetic breast cancer women from metastasis.
26893016 2016 Circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3 and terminal duct lobular unit involution of the breast: a cross-sectional study of women with benign breast disease.
More...