Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.39
PubTator Score 1.74

Knowledge Summary

Patent

No data available

Gene RIF (48)

AA Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQ      1 - 70
FQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSI     71 - 140
LAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD                         141 - 189
//

Text Mined References (11)

PMID Year Title