Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.36
PubTator Score 24.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Protein-protein Interaction (5)

Gene RIF (52)

AA Sequence

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQ      1 - 70
FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI     71 - 140
LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD                         141 - 189
//

Text Mined References (17)

PMID Year Title