Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.40
PubTator Score 14.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Myocarditis 18 3.876 1.9

Gene RIF (55)

AA Sequence

MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQ      1 - 70
FQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSI     71 - 140
LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE                         141 - 189
//

Text Mined References (18)

PMID Year Title