Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.62
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Synonym

Accession P05000 Q13168 Q5U802 Q5VWD0 Q7M4P5
Symbols

Gene

PDB

3SE4  

Gene RIF (13)

PMID Text
22192711 Studies indicate that upregulation of the type I interferon protein signature has added additional markers of disease activity and insight into the pathogenesis of the disease.
21854986 The crystal structures of two human type I IFN ternary signaling complexes containing IFNalpha2 and IFNomega reveal recognition modes and heterotrimeric architectures that are unique among the cytokine receptor superfamily but conserved between type I IFNs.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20574843 Single nucleotide polymorphism in ACO1 gene is associated with skin pigmentation.
20574843 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19863576 Data show that a novel c.1344delC mutation in AIRE and anti-IFN-omega antibodies appear very early in life are helpful to differentiate APS I from other multi-organ autoimmune diseases.
16504056 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQ      1 - 70
LQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPA     71 - 140
LTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS                   141 - 195
//

Text Mined References (23)

PMID Year Title
22192711 2011 Type I interferon pathway in adult and juvenile dermatomyositis.
21854986 2011 Structural linkage between ligand discrimination and receptor activation by type I interferons.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19863576 2010 Novel sequence variation of AIRE and detection of interferon-omega antibodies in early infancy.
16504056 2006 Polymorphism discovery and association analyses of the interferon genes in type 1 diabetes.
15621727 2004 Human interferons alpha, beta and omega.
More...