Property Summary

NCBI Gene PubMed Count 39
Grant Count 171
R01 Count 90
Funding $36,118,514.32
PubMed Score 682.67
PubTator Score 427.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession P04921 B2R522 Q53SV9 Q92642
Symbols GE
GPC
GPD
GYPD
CD236
PAS-2
CD236R
PAS-2'

Gene

PDB

2EJY  

Gene RIF (12)

PMID Text
25011110 Plasmodium falciparum STEVOR functions as an erythrocyte-binding protein that recognizes Glycophorin C (GPC) on the red blood cell (RBC) surface and that its binding correlates with the level of GPC on the RBC surface.
24652986 Rosetting assays using CD236R knockdown normocytes derived from hematopoietic stem cells further supports the role of glycophorin C as a receptor in P vivax rosette formation.
24379273 Precise definition of the binding site for the EBA-140 ligand on glycophorin C may be important with respect to human erythrocyte invasion inhibition strategies based on a receptor.
21061946 Glycophorin C delta (exon3) is not associated with protection against severe anaemia in Papua New Guinea.
20932076 The Gerbich blood group system
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19679754 The molecular evolution of GYPC among the Hominoidea (Greater and Lesser Apes) and the pattern of polymorphism at the locus in a global human sample, were examined.
19149918 A high GYPC gene expression is associated with an unfavorable outcome, in contrast, a high TRIP3 gene expression is associated with a favorable outcome in childhood ALL.
14695625 Neither mutation was associated with altered susceptibility to asymptomatic Plasmodium falciparum or P. vivax infection. Contribution of these erythrocyte polymorphisms to susceptibility to clinical malaria morbidity requires further study.
12576308 Glycophorin C is identified as the receptor for PfEBP-2, the erythrocyte binding ligand of Plasmodium falciparum, and the binding domain on GPC is determined to be amino acid residues 14 through 22 within exon 2.
More...

AA Sequence

MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVA      1 - 70
IVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI                 71 - 128
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25011110 2014 STEVOR is a Plasmodium falciparum erythrocyte binding protein that mediates merozoite invasion and rosetting.
24652986 2014 Glycophorin C (CD236R) mediates vivax malaria parasite rosetting to normocytes.
24379273 2013 [Human erythrocyte glycophorin C as the receptor for EBA-140 Plasmodium falciparum merozoite ligand].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21061946 Glycophorin C delta(exon3) is not associated with protection against severe anaemia in Papua New Guinea.
20932076 2010 The Gerbich blood group system: a review.
More...