Property Summary

NCBI Gene PubMed Count 40
PubMed Score 722.89
PubTator Score 427.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy -1.324 2.7e-07
adrenocortical carcinoma -1.552 1.6e-05
Astrocytoma, Pilocytic 1.800 1.4e-07
breast carcinoma -1.100 8.9e-04
colon cancer -1.200 2.6e-03
cystic fibrosis 1.362 7.9e-06
dermatomyositis -1.600 2.0e-03
diabetes mellitus -1.100 7.9e-03
ductal carcinoma in situ -1.800 3.9e-04
fibroadenoma -1.200 1.6e-02
glioblastoma 1.600 5.2e-03
intraductal papillary-mucinous adenoma (... -1.300 1.5e-03
intraductal papillary-mucinous carcinoma... -1.200 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
invasive ductal carcinoma -2.100 5.7e-04
lung adenocarcinoma -1.100 3.3e-16
lung cancer -1.700 5.7e-03
lung carcinoma -1.900 9.7e-25
malignant mesothelioma 1.600 2.5e-06
non-small cell lung cancer -1.768 8.1e-23
osteosarcoma -2.621 1.3e-03
pediatric high grade glioma 1.100 1.2e-04
spina bifida 1.176 4.6e-02
subependymal giant cell astrocytoma 1.686 1.2e-02

Gene RIF (13)

AA Sequence

MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVA      1 - 70
IVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI                 71 - 128
//

Text Mined References (46)

PMID Year Title