Property Summary

NCBI Gene PubMed Count 51
PubMed Score 27.49
PubTator Score 95.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 5.7e-03
ependymoma 1.500 4.0e-03
glioblastoma 2.700 2.9e-08
medulloblastoma 1.800 5.8e-05
atypical teratoid / rhabdoid tumor 2.600 8.0e-11
medulloblastoma, large-cell 2.900 8.5e-07
lung cancer 1.200 1.3e-04
pediatric high grade glioma 2.000 2.8e-06
ovarian cancer 1.100 1.4e-04

Gene RIF (24)

PMID Text
23121767 A novel signal pathway involved in gastrin-stimulated AE2 expression mediated by EGR1 in gastric cancer cells.
22802585 AE2 is a major pathway for basolateral Cl(-) loading during cAMP-stimulated secretion of Cl(-) and fluid by Calu-3 cells
22383162 miR-506 is up-regulated in primary biliary cirrhosis, binds the 3'UTR region of AE2 mRNA, and prevents protein translation, leading to diminished AE2 activity and impaired biliary secretory functions.
21691115 Dysfunctions related to AE2 might have a role in the pathogenesis of primary biliary cirrhosis.
21594562 CTLA4 and SLC4A2 genetic polymorphisms are differentially associated with primary biliary cirrhosis development and progression, as well as anti-gp210 or anti-centromere antibody production, in Japanese PBC patients
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20180022 AE2 mediated-apoptosis of endothelial cells induced by high glucose was Caspase-3-dependent.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19491853 The common genetic variation of SLC4A2 does not directly affect the risk of PBC or its clinical outcome.
19491853 Observational study of gene-disease association. (HuGE Navigator)
19224338 that AE2 may play an important role in the progression of hepatocellular carcinoma cells
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18930330 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18438347 AE2 might be associated with gastric carcinogenesis and the achlorhydria experienced by gastric cancer patients.
17652430 SLC4A2 colocalized with carbonic anhydrase IX in gastric mucosa.
17058451 The results indicated that overexpression of AE2 may be involved in the development of human HCC.
14575719 findings suggest that HNF1 may have a major role in upregulating alternative transcription of the AE2 gene in the liver, and therefore it may contribute to the biliary secretion of bicarbonate in response to certain stimuli
12225956 Oxidative stress activates anion exchange protein 2 and AP-1 in airway epithelial cells.
11852051 AE2 operates in parallel with NHE1 to regulate pH(i) during RVD of human cervical cancer cells.

AA Sequence

MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEILQEAGSRGGEEPGRSYGEED      1 - 70
FEYHRQSSHHIHHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPTIEEGEEDEDEASEAEGARAL     71 - 140
TQPSPVSTPSSVQFFLQEDDSADRKAERTSPSSPAPLPHQEATPRASKGAQAGTQVEEAEAEAVAVASGT    141 - 210
AGGDDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFED    211 - 280
VPGVRRHLVRKNAKGSTQSGREGREPGPTPRARPRAPHKPHEVFVELNELLLDKNQEPQWRETARWIKFE    281 - 350
EDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVL    351 - 420
RALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDPHVTEPLMGGVPETRLEVERERELPPPA    421 - 490
PPAGITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLL    491 - 560
GPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELLRSVAHFQ    561 - 630
RQMLKKREEQGRLLPTGAGLEPKSAQDKALLQMVEAAGAAEDDPLRRTGRPFGGLIRDVRRRYPHYLSDF    631 - 700
RDALDPQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGP    701 - 770
LLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETF    771 - 840
YKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAG    841 - 910
TFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQKLSVPSGFSVTAPEKRGWVI    911 - 980
NPLGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFG    981 - 1050
LPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFG   1051 - 1120
IFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTLRMHLFTALQLLCLALLWAVMSTAASLAFP   1121 - 1190
FILILTVPLRMVVLTRIFTDREMKCLDANEAEPVFDEREGVDEYNEMPMPV                      1191 - 1241
//

Text Mined References (63)

PMID Year Title
27543333 2016 Stromal uptake and transmission of acid is a pathway for venting cancer cell-generated acid.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121767 2013 EGR1 is critical for gastrin-dependent upregulation of anion exchanger 2 in gastric cancer cells.
22802585 2012 Basolateral chloride loading by the anion exchanger type 2: role in fluid secretion by the human airway epithelial cell line Calu-3.
22383162 2012 Up-regulation of microRNA 506 leads to decreased Cl-/HCO3- anion exchanger 2 expression in biliary epithelium of patients with primary biliary cirrhosis.
21691115 2011 Role of the anion exchanger 2 in the pathogenesis and treatment of primary biliary cirrhosis.
21594562 2011 Genetic polymorphisms in CTLA4 and SLC4A2 are differentially associated with the pathogenesis of primary biliary cirrhosis in Japanese patients.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20180022 2010 Involvement of anion exchanger-2 in apoptosis of endothelial cells induced by high glucose through an mPTP-ROS-Caspase-3 dependent pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19491853 2009 Common genetic variation and haplotypes of the anion exchanger SLC4A2 in primary biliary cirrhosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19224338 2009 Reduction of anion exchanger 2 expression induces apoptosis of human hepatocellular carcinoma cells.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18930330 2008 Genetic factors of susceptibility and of severity in primary biliary cirrhosis.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18438347 2008 Expression of anion exchanger 2 in human gastric cancer.
17652430 2007 Interactions of transmembrane carbonic anhydrase, CAIX, with bicarbonate transporters.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17058451 2006 Overexpression of anion exchanger 2 in human hepatocellular carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14575719 2003 HNF1alpha upregulates the human AE2 anion exchanger gene (SLC4A2) from an alternate promoter.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12225956 2002 Oxidative stress activates anion exchange protein 2 and AP-1 in airway epithelial cells.
11852051 2002 Anion exchanger isoform 2 operates in parallel with Na(+)/H(+) exchanger isoform 1 during regulatory volume decrease of human cervical cancer cells.
11842009 2002 Identification of an apical Cl(-)/HCO3(-) exchanger in the small intestine.
11248201 2001 Human intestinal anion exchanger isoforms: expression, distribution, and membrane localization.
11208611 2001 Pendrin: an apical Cl-/OH-/HCO3- exchanger in the kidney cortex.
11156694 2001 Identification of the full-length AE2 (AE2a) isoform as the Golgi-associated anion exchanger in fibroblasts.
10820026 2000 Identification of the carbonic anhydrase II binding site in the Cl(-)/HCO(3)(-) anion exchanger AE1.
10623603 2000 Tissue-specific N-terminal isoforms from overlapping alternate promoters of the human AE2 anion exchanger gene.
10577919 1999 Localization of a gene for autosomal recessive distal renal tubular acidosis with normal hearing (rdRTA2) to 7q33-34.
10491633 1999 Primary structure of a sperm cell anion exchanger and its messenger ribonucleic acid expression during spermatogenesis.
10491290 1999 Chloride-bicarbonate exchangers in the human fetal pancreas.
10452823 1998 Expression of cation exchanger NHE and anion exchanger AE isoforms in primary human bone-derived osteoblasts.
9587054 1998 Anion exchanger 2 (AE2) binds to erythrocyte ankyrin and is colocalized with ankyrin along the basolateral plasma membrane of human gastric parietal cells.
9477304 1998 In situ detection of AE2 anion-exchanger mRNA in the human liver.
9027488 1997 Molecular cloning and characterization of the human AE2 anion exchanger (SLC4A2) gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8434259 1993 Molecular and cellular biology of the erythrocyte anion exchanger (AE1).
7984058 1994 Expression of the anion exchanger (AE) gene family in human brain. Identification of a new AE protein: AE0.
7626035 1995 Identification of a band-3 binding site near the N-terminus of erythrocyte membrane protein 4.2.
3020980 1986 Chromosomal localization of a human band 3-like gene to region 7q35----7q36.
3015590 1986 Cloning and structural characterization of a human non-erythroid band 3-like protein.
2968981 1988 Associations of human erythrocyte band 4.2. Binding to ankyrin and to the cytoplasmic domain of band 3.
1562608 1992 Complete nucleotide sequence of band 3 related anion transport protein AE2 from human kidney.