Property Summary

NCBI Gene PubMed Count 51
Grant Count 10
R01 Count 10
Funding $2,392,168.25
PubMed Score 27.49
PubTator Score 95.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 0.006
ependymoma 1.500 0.004
glioblastoma 2.700 0.000
medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 2.600 0.000
medulloblastoma, large-cell 2.900 0.000
lung cancer 1.200 0.000
pediatric high grade glioma 2.000 0.000
ovarian cancer 1.100 0.000

Gene RIF (24)

PMID Text
23121767 A novel signal pathway involved in gastrin-stimulated AE2 expression mediated by EGR1 in gastric cancer cells.
22802585 AE2 is a major pathway for basolateral Cl(-) loading during cAMP-stimulated secretion of Cl(-) and fluid by Calu-3 cells
22383162 miR-506 is up-regulated in primary biliary cirrhosis, binds the 3'UTR region of AE2 mRNA, and prevents protein translation, leading to diminished AE2 activity and impaired biliary secretory functions.
21691115 Dysfunctions related to AE2 might have a role in the pathogenesis of primary biliary cirrhosis.
21594562 CTLA4 and SLC4A2 genetic polymorphisms are differentially associated with primary biliary cirrhosis development and progression, as well as anti-gp210 or anti-centromere antibody production, in Japanese PBC patients
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20180022 AE2 mediated-apoptosis of endothelial cells induced by high glucose was Caspase-3-dependent.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEILQEAGSRGGEEPGRSYGEED      1 - 70
FEYHRQSSHHIHHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPTIEEGEEDEDEASEAEGARAL     71 - 140
TQPSPVSTPSSVQFFLQEDDSADRKAERTSPSSPAPLPHQEATPRASKGAQAGTQVEEAEAEAVAVASGT    141 - 210
AGGDDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFED    211 - 280
VPGVRRHLVRKNAKGSTQSGREGREPGPTPRARPRAPHKPHEVFVELNELLLDKNQEPQWRETARWIKFE    281 - 350
EDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVL    351 - 420
RALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDPHVTEPLMGGVPETRLEVERERELPPPA    421 - 490
PPAGITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLL    491 - 560
GPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELLRSVAHFQ    561 - 630
RQMLKKREEQGRLLPTGAGLEPKSAQDKALLQMVEAAGAAEDDPLRRTGRPFGGLIRDVRRRYPHYLSDF    631 - 700
RDALDPQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGP    701 - 770
LLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETF    771 - 840
YKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAG    841 - 910
TFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQKLSVPSGFSVTAPEKRGWVI    911 - 980
NPLGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALFG    981 - 1050
LPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFG   1051 - 1120
IFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTLRMHLFTALQLLCLALLWAVMSTAASLAFP   1121 - 1190
FILILTVPLRMVVLTRIFTDREMKCLDANEAEPVFDEREGVDEYNEMPMPV                      1191 - 1241
//

Text Mined References (63)

PMID Year Title
27543333 2016 Stromal uptake and transmission of acid is a pathway for venting cancer cell-generated acid.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121767 2013 EGR1 is critical for gastrin-dependent upregulation of anion exchanger 2 in gastric cancer cells.
22802585 2012 Basolateral chloride loading by the anion exchanger type 2: role in fluid secretion by the human airway epithelial cell line Calu-3.
22383162 2012 Up-regulation of microRNA 506 leads to decreased Cl-/HCO3- anion exchanger 2 expression in biliary epithelium of patients with primary biliary cirrhosis.
21691115 2011 Role of the anion exchanger 2 in the pathogenesis and treatment of primary biliary cirrhosis.
21594562 2011 Genetic polymorphisms in CTLA4 and SLC4A2 are differentially associated with the pathogenesis of primary biliary cirrhosis in Japanese patients.
More...