Property Summary

NCBI Gene PubMed Count 25
PubMed Score 18.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04908 P28001 Q76P63
Symbols H2A/m
H2AFM

Gene

PDB

2CV5   2RVQ   3A6N   3AFA   3AN2   3AV1   3AV2   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3WTP   3X1S   3X1V   4YM5   4YM6   4Z5T   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5AY8   5B0Y   5B0Z   5B24   5B2I   5B2J   5B31   5B32   5B40   5CPI   5CPJ   5CPK  

 GO Function (1)

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (39)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23956221 2013 Increasing the complexity of chromatin: functionally distinct roles for replication-dependent histone H2A isoforms in cell proliferation and carcinogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...