Property Summary

NCBI Gene PubMed Count 27
PubMed Score 18.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -2.900 7.3e-03
atypical teratoid / rhabdoid tumor 1.500 9.6e-03
Breast cancer 2.700 3.1e-02
ductal carcinoma in situ 1.900 2.3e-02
group 3 medulloblastoma 1.400 2.0e-02
intraductal papillary-mucinous carcinoma... 1.700 8.4e-03
invasive ductal carcinoma 3.400 6.8e-03
lung adenocarcinoma 1.100 8.2e-12
lung cancer 1.200 1.0e-02
non-small cell lung cancer 1.134 1.9e-12
non-small cell lung carcinoma 1.100 6.7e-23
ovarian cancer 1.500 4.5e-05
pituitary cancer 1.100 4.4e-03
psoriasis -2.100 4.6e-05

PDB (55)

Gene RIF (5)

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (45)

PMID Year Title