Property Summary

NCBI Gene PubMed Count 124
Grant Count 1
Funding $51,478.1
PubMed Score 16.58
PubTator Score 25.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.016
glioblastoma 1.600 0.000
posterior fossa group A ependymoma 1.100 0.000
ulcerative colitis 1.200 0.000

Synonym

Accession P04899 B3KTZ0 B4DYA0 B4E2X5 Q6B6N3 Q8IZ71
Symbols GIP
GNAI2B
H_LUCA15.1
H_LUCA16.1

Gene

 Grant Application (1)

Gene RIF (38)

PMID Text
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
25788576 Galpha(i2) activates the TRPC4 channel by direct binding.
25078664 We observed increased expression of Galphai1/3 in wounded human skin and keloid skin tissues, suggesting the possible involvement of Galphai1/3 in wound healing and keloid formation.
24423449 Data strongly implicate GNAI2 as a critical regulator of oncogenesis and an upstream driver of cancer progression in ovarian carcinoma.
24415754 HIV-1 gp120-mediated phosphorylation of WAVE2 requires both G(alpha)i-dependent and -independent pathways, and is conserved both in X4 and R5 viral infection of resting CD4 T cells and primary macrophages
24298018 Galphai2(Q205L) regulates satellite cell differentiation into myotubes in a protein kinase C - and histone deacetylase -dependent manner
24011658 Changes in ion selectivity and pore dilation of the TRPC4 channel elicited by the Galphai2 subunit, were studied.
23665327 The ubiquitination of Galphai2 and Galphaq is suppressed by expression of Ric-8A. The suppression likely requires Ric-8A interaction with these Galpha proteins; the C-terminal truncation of Galphaq and Galphai2 completely abrogates their interaction with Ric-8A.
23490066 There is an interaction between the activated Gsalpha subunit and membrane lipid microdomains in the pathophysiology of some major depressive disorders.
23430985 These results suggest that the extent of G-protein-mediated inhibition is significantly reduced in the K1336E mutant CaV2.1 Ca(2+) channels
More...

AA Sequence

MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR      1 - 70
AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC     71 - 140
FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT    211 - 280
HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK    281 - 350
DCGLF                                                                     351 - 355
//

Text Mined References (132)

PMID Year Title
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25788576 2015 Close spatio-association of the transient receptor potential canonical 4 (TRPC4) channel with G?i in TRPC4 activation process.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24423449 2014 Suppression of GNAI2 message in ovarian cancer.
More...