Property Summary

NCBI Gene PubMed Count 126
PubMed Score 17.18
PubTator Score 25.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.600 3.9e-07
posterior fossa group A ependymoma 1.100 8.3e-05
Rheumatoid arthritis -1.500 1.6e-02
ulcerative colitis 1.200 7.9e-05

Gene RIF (38)

AA Sequence

MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR      1 - 70
AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC     71 - 140
FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK    141 - 210
KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT    211 - 280
HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK    281 - 350
DCGLF                                                                     351 - 355
//

Text Mined References (134)

PMID Year Title