Property Summary

NCBI Gene PubMed Count 28
Grant Count 4
R01 Count 3
Funding $216,774.84
PubMed Score 30.03
PubTator Score 32.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04844 Q5JYR6 Q6IBA5 Q96E21 Q9BUQ3 Q9UBE1
Symbols SWP1
RPNII
RIBIIR
RPN-II

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (10)

PMID Text
25595901 Data suggest that RPN2 is involved in the regulation of lethal cancer phenotypes and represents a promising new target for RNAi-based medicine against non-small cell lung cancer.
24884960 these results indicated that high glycosylation of CD63 by RPN2 is implicated in clinical outcomes in breast cancer patients
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
23959174 Furthermore, our study reveals that high expression of RPN2 and concomitant accumulation of mtp53 were associated with cancer tissues in a small cohort of metastatic breast cancer patients.
23166591 Expression of HIV-1 Tat upregulates the abundance of ribophorin II (RPN2) in the nucleoli of Jurkat T-cells
20471946 Rpn13 binding to the proteasome scaffolding protein hRpn2/S1 abrogates its interdomain interactions, thus activating hRpn13 for ubiquitin binding.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19617345 Data show that the decay of metabolically labeled p53 follows biphasic kinetics, while 20 S proteasome executes the first phase by default, and the second phase requires the 26 S proteasome.
19549781 S-glutathionylation of Rpn2 is a contributory mechanism for H2O2-induced inhibition of 26 S proteasomal function
18724378 RPN2 gene confers docetaxel resistance in breast cancer.

AA Sequence

MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKK      1 - 70
ACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLA     71 - 140
SQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTAL    141 - 210
FVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSAS    211 - 280
DTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLV    281 - 350
EVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL    351 - 420
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATL    421 - 490
KNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALW    491 - 560
IRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTA    561 - 630
H//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25595901 2015 Prognostic and therapeutic impact of RPN2-mediated tumor malignancy in non-small-cell lung cancer.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24884960 2014 RPN2-mediated glycosylation of tetraspanin CD63 regulates breast cancer cell malignancy.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23959174 2013 Ribophorin II regulates breast tumor initiation and metastasis through the functional suppression of GSK3?.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21269460 2011 Initial characterization of the human central proteome.
20471946 2010 Structure of proteasome ubiquitin receptor hRpn13 and its activation by the scaffolding protein hRpn2.
More...