Property Summary

NCBI Gene PubMed Count 29
PubMed Score 29.88
PubTator Score 32.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.200 3.7e-05
astrocytoma 2.100 9.0e-04
Astrocytoma, Pilocytic 1.200 1.6e-07
atypical teratoid / rhabdoid tumor 1.800 4.1e-10
Breast cancer 2.200 4.5e-02
dermatomyositis 1.600 1.9e-03
diabetes mellitus -1.200 8.7e-03
ependymoma 1.500 1.6e-02
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 1.400 2.2e-11
group 3 medulloblastoma 1.100 6.2e-04
intraductal papillary-mucinous carcinoma... 1.100 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 9.7e-03
invasive ductal carcinoma 1.200 1.3e-04
juvenile dermatomyositis 1.253 4.5e-13
lung adenocarcinoma 1.549 2.1e-10
lung cancer 1.400 1.9e-04
medulloblastoma, large-cell 1.600 5.8e-06
non-small cell lung cancer 1.033 2.5e-20
oligodendroglioma 1.300 9.0e-03
osteosarcoma 1.403 1.4e-03
ovarian cancer -1.100 4.1e-05
primitive neuroectodermal tumor 1.200 7.8e-05
subependymal giant cell astrocytoma 1.678 2.1e-03

 GO Function (1)

Gene RIF (11)

AA Sequence

MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKK      1 - 70
ACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLA     71 - 140
SQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTAL    141 - 210
FVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSAS    211 - 280
DTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLV    281 - 350
EVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL    351 - 420
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATL    421 - 490
KNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALW    491 - 560
IRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTA    561 - 630
H//

Text Mined References (35)

PMID Year Title