Property Summary

Ligand Count 6
NCBI Gene PubMed Count 269
PubMed Score 1276.83
PubTator Score 631.10

Knowledge Summary

Patent (6,712)

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
diabetes mellitus -1.500 9.8e-03
adrenocortical carcinoma -1.654 1.6e-03
astrocytoma 1.700 1.0e-02
Astrocytoma, Pilocytic 1.600 7.4e-05
atypical teratoid / rhabdoid tumor -1.400 1.1e-02
Chronic Lymphocytic Leukemia -1.186 7.0e-04
cutaneous lupus erythematosus 2.800 1.2e-03
glioblastoma 1.400 1.7e-02
group 4 medulloblastoma -1.200 8.9e-03
head and neck cancer and chronic obstruc... 1.600 6.2e-04
interstitial cystitis 2.100 3.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 7.8e-03
invasive ductal carcinoma 1.230 2.1e-03
lung cancer -2.500 4.5e-04
lung carcinoma -2.900 9.5e-27
medulloblastoma, large-cell -2.100 1.3e-04
mucosa-associated lymphoid tissue lympho... 3.139 5.5e-03
non-small cell lung cancer -1.203 7.9e-07
osteosarcoma -2.040 1.0e-02
ovarian cancer -1.400 1.6e-05
pediatric high grade glioma 1.100 9.0e-03
primary Sjogren syndrome 2.200 1.7e-05
subependymal giant cell astrocytoma 1.619 3.1e-02
tuberculosis 1.400 2.3e-06
ulcerative colitis 1.300 2.4e-04

 IMPC Phenotype (1)

Gene RIF (244)

AA Sequence

MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP      1 - 70
VCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA     71 - 140
LSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH    141 - 210
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY    211 - 280
LCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF    281 - 350
FSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL    351 - 420
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH    421 - 490
FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG    491 - 560
VHFIFNKENF                                                                561 - 570
//

Text Mined References (279)

PMID Year Title