Property Summary

NCBI Gene PubMed Count 239
Grant Count 492
R01 Count 330
Funding $40,175,825.17
PubMed Score 1149.67
PubTator Score 631.10

Knowledge Summary

Patent (6,712)

TINX Plot

  Disease Relevance (47)

Expression

Synonym

Accession P04839 A8K138 Q2PP16
Symbols CGD
NOX2
IMD34
AMCBX2
GP91-1
GP91PHOX
p91-PHOX
GP91-PHOX

Gene

PANTHER Protein Class (2)

PDB

3A1F  

 IMPC Term (1)

Gene RIF (217)

PMID Text
26498406 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration
26464403 Female patients with severe inflammatory bowel disease should be checked for X-CGD genes.
26354779 NOX2 is the source of HPV-induced oxidative stress in the pathogenesis of head and neck cancer.
26333777 results indicate that platelet and neutrophil NOX2-produced ROS are critical for the function of surface receptors essential for neutrophil-platelet interactions during vascular inflammation.
26317224 increased levels of gp91phox, p47phox and p22phox likely account for the interferon-gamma mediated enhancement of dimethyl sulfoxide-induced Nox2 activity.
26177467 Blunting of NOX2-dependent IKKepsilon oncogenic kinase expression reduces proliferation and viability of human breast cancer cells.
26160850 results reveal an essential role for the Cys-Gly-Cys triad in Nox2 in binding p67(phox), seconded by an additional binding region, comprising residues C terminal to Cys-Gly-Cys. The 2 regions interact with distinct partner sites in p67(phox).
26116564 Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK.
26079697 Ethanol-induced HMGB1 release is associated with NOX2/NLRP1 inflammasome signaling, which represents a novel mechanism of ethanol-associated neuron injury.
26076008 NOX2 activity does not play a key role in tumor development or immune cell infiltration in the chemically induced MCA sarcoma model.
More...

AA Sequence

MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP      1 - 70
VCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA     71 - 140
LSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH    141 - 210
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY    211 - 280
LCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF    281 - 350
FSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL    351 - 420
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH    421 - 490
FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG    491 - 560
VHFIFNKENF                                                                561 - 570
//

Text Mined References (249)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26498406 2016 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration.
26464403 2016 Diagnostic and Treatment Options for Severe IBD in Female X-CGD Carriers with Non-random X-inactivation.
26354779 2015 HPV16 E6 and E7 proteins induce a chronic oxidative stress response via NOX2 that causes genomic instability and increased susceptibility to DNA damage in head and neck cancer cells.
26333777 2015 NOX2 is critical for heterotypic neutrophil-platelet interactions during vascular inflammation.
26317224 2015 INF-? Enhances Nox2 Activity by Upregulating phox Proteins When Applied to Differentiating PLB-985 Cells but Does Not Induce Nox2 Activity by Itself.
26177467 2015 Redox-modulating agents target NOX2-dependent IKK? oncogenic kinase expression and proliferation in human breast cancer cell lines.
26160850 2015 A Cys-Gly-Cys triad in the dehydrogenase region of Nox2 plays a key role in the interaction with p67phox.
26116564 2015 NOX1 to NOX2 switch deactivates AMPK and induces invasive phenotype in colon cancer cells through overexpression of MMP-7.
26079697 2015 Ethanol directly induced HMGB1 release through NOX2/NLRP1 inflammasome in neuronal cells.
More...