Property Summary

Ligand Count 10
NCBI Gene PubMed Count 269
PubMed Score 1276.83
PubTator Score 631.10

Knowledge Summary

Patent (6,712)

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
diabetes mellitus -1.500 9.8e-03
adrenocortical carcinoma -1.654 1.6e-03
astrocytoma 1.700 1.0e-02
Astrocytoma, Pilocytic 1.600 7.4e-05
atypical teratoid / rhabdoid tumor -1.400 1.1e-02
Chronic Lymphocytic Leukemia -1.186 7.0e-04
cutaneous lupus erythematosus 2.800 1.2e-03
glioblastoma 1.400 1.7e-02
group 4 medulloblastoma -1.200 8.9e-03
head and neck cancer and chronic obstruc... 1.600 6.2e-04
interstitial cystitis 2.100 3.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 7.8e-03
invasive ductal carcinoma 1.230 2.1e-03
lung cancer -2.500 4.5e-04
lung carcinoma -2.900 9.5e-27
medulloblastoma, large-cell -2.100 1.3e-04
mucosa-associated lymphoid tissue lympho... 3.139 5.5e-03
non-small cell lung cancer -1.203 7.9e-07
osteosarcoma -2.040 1.0e-02
ovarian cancer -1.400 1.6e-05
pediatric high grade glioma 1.100 9.0e-03
primary Sjogren syndrome 2.200 1.7e-05
subependymal giant cell astrocytoma 1.619 3.1e-02
tuberculosis 1.400 2.3e-06
ulcerative colitis 1.300 2.4e-04

 IMPC Phenotype (1)

Gene RIF (244)

AA Sequence

MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP      1 - 70
VCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA     71 - 140
LSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH    141 - 210
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY    211 - 280
LCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF    281 - 350
FSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL    351 - 420
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH    421 - 490
FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG    491 - 560
VHFIFNKENF                                                                561 - 570
//

Text Mined References (279)

PMID Year Title