Property Summary

NCBI Gene PubMed Count 239
PubMed Score 1149.67
PubTator Score 631.10

Knowledge Summary

Patent (6,712)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 9.47482465649095E-27
ovarian cancer 8492 2.96054488632685E-9
non-small cell lung cancer 2798 1.33534384375462E-8
tuberculosis 1563 2.25815807288698E-6
primary Sjogren syndrome 789 1.65604064804113E-5
ulcerative colitis 2087 3.67774750829177E-5
pilocytic astrocytoma 3086 7.99612309021354E-5
lung cancer 4473 8.85770654029009E-5
medulloblastoma, large-cell 6234 1.34562403596023E-4
head and neck cancer and chronic obstructive pulmonary disease 237 5.91062666546983E-4
chronic lymphocytic leukemia 244 0.00109604918061717
cutaneous lupus erythematosus 1056 0.00124701577773584
adrenocortical carcinoma 1427 0.00164304843685102
glioblastoma 5572 0.00179743834910632
invasive ductal carcinoma 2950 0.00211189464269687
interstitial cystitis 2299 0.00334044461717487
mucosa-associated lymphoid tissue lymphoma 480 0.00548443525379947
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0078203166900171
group 4 medulloblastoma 1875 0.00888172757081733
pediatric high grade glioma 2712 0.00900374199106232
osteosarcoma 7933 0.0100276325991934
astrocytoma 1493 0.0100862053593902
atypical teratoid / rhabdoid tumor 4369 0.0106898485846732
subependymal giant cell astrocytoma 2287 0.0308743189717852
Disease Target Count
Immunodeficiency 34 1

Expression

Synonym

Accession P04839 A8K138 Q2PP16
Symbols CGD
NOX2
IMD34
AMCBX2
GP91-1
GP91PHOX
p91-PHOX
GP91-PHOX

Gene

PANTHER Protein Class (2)

PDB

3A1F  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 IMPC Term (1)

Gene RIF (214)

PMID Text
26498406 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration
26464403 Female patients with severe inflammatory bowel disease should be checked for X-CGD genes.
26354779 NOX2 is the source of HPV-induced oxidative stress in the pathogenesis of head and neck cancer.
26333777 results indicate that platelet and neutrophil NOX2-produced ROS are critical for the function of surface receptors essential for neutrophil-platelet interactions during vascular inflammation.
26317224 increased levels of gp91phox, p47phox and p22phox likely account for the interferon-gamma mediated enhancement of dimethyl sulfoxide-induced Nox2 activity.
26177467 Blunting of NOX2-dependent IKKepsilon oncogenic kinase expression reduces proliferation and viability of human breast cancer cells.
26160850 results reveal an essential role for the Cys-Gly-Cys triad in Nox2 in binding p67(phox), seconded by an additional binding region, comprising residues C terminal to Cys-Gly-Cys. The 2 regions interact with distinct partner sites in p67(phox).
26116564 Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK.
26079697 Ethanol-induced HMGB1 release is associated with NOX2/NLRP1 inflammasome signaling, which represents a novel mechanism of ethanol-associated neuron injury.
26076008 NOX2 activity does not play a key role in tumor development or immune cell infiltration in the chemically induced MCA sarcoma model.
More...

AA Sequence

MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP      1 - 70
VCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA     71 - 140
LSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH    141 - 210
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY    211 - 280
LCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF    281 - 350
FSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL    351 - 420
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH    421 - 490
FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG    491 - 560
VHFIFNKENF                                                                561 - 570
//

Text Mined References (249)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26498406 2016 Critical role of the Mac1/NOX2 pathway in mediating reactive microgliosis-generated chronic neuroinflammation and progressive neurodegeneration.
26464403 2016 Diagnostic and Treatment Options for Severe IBD in Female X-CGD Carriers with Non-random X-inactivation.
26354779 2015 HPV16 E6 and E7 proteins induce a chronic oxidative stress response via NOX2 that causes genomic instability and increased susceptibility to DNA damage in head and neck cancer cells.
26333777 2015 NOX2 is critical for heterotypic neutrophil-platelet interactions during vascular inflammation.
26317224 2015 INF-? Enhances Nox2 Activity by Upregulating phox Proteins When Applied to Differentiating PLB-985 Cells but Does Not Induce Nox2 Activity by Itself.
26177467 2015 Redox-modulating agents target NOX2-dependent IKK? oncogenic kinase expression and proliferation in human breast cancer cell lines.
26160850 2015 A Cys-Gly-Cys triad in the dehydrogenase region of Nox2 plays a key role in the interaction with p67phox.
26116564 2015 NOX1 to NOX2 switch deactivates AMPK and induces invasive phenotype in colon cancer cells through overexpression of MMP-7.
26079697 2015 Ethanol directly induced HMGB1 release through NOX2/NLRP1 inflammasome in neuronal cells.
More...