Property Summary

NCBI Gene PubMed Count 483
Grant Count 351
R01 Count 225
Funding $42,780,176.79
PubMed Score 722.73
PubTator Score 609.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (74)

Disease Z-score Confidence
Cancer 2,346 5.717 2.9
Diarrhea 155 3.584 1.8
Neutropenia 78 3.227 1.6
Actinic keratosis 22
Adenocarcinoma of pancreas 12
Adverse reaction to drug 54
Anemia 252
Atopic dermatitis 944
Brain Diseases 22
Breast cancer 3,094
Cleft Lip 91
Cleft palate 125
Colonic Neoplasms 126
Colorectal Neoplasms 217
Digestive System Neoplasms 2
Down syndrome 548
Endometriosis 535
Head and Neck Neoplasms 23
Hyperammonemia 5
IGA Glomerulonephritis 454
Liver carcinoma 217
Lung Neoplasms 171
Lymph Node Positive Colorectal Carcinoma 1
Lymphoma, Follicular 20
Lymphoma, Non-Hodgkin 22
Malignant mesothelioma of pleura 7
Malignant neoplasm of liver 1
Malignant tumor of colon 3
Malignant tumor of stomach 12
Mammary Neoplasms 410
Metastasis from malignant tumor of colon 8
Metastatic Breast Carcinoma 21
Neoplasm Recurrence, Local 23
Neuroendocrine Tumors 10
Pancreatic Neoplasm 79
Pick disease 1,893
Primary malignant neoplasm of gastrointe... 1 
Prostatic Neoplasms 471
Rectal Neoplasms 7
Squamous cell carcinoma 94
Stomach Neoplasms 282
Superficial basal cell carcinoma 2
Tongue Neoplasms 8
Waldenstrons macroglobulinemia 765
adrenocortical carcinoma 1,427
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
group 3 medulloblastoma 2,254
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
nervous system disorder 53
non-small cell lung cancer 2,798
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
progressive supranuclear palsy 674
psoriasis 6,685
tuberculosis 1,557

Expression

Synonym

Accession P04818 Q8WYK3 Q8WYK4 TS
Symbols TS
TMS
HST422

Gene

PANTHER Protein Class (2)

PDB

1HVY   1HW3   1HW4   1HZW   1I00   1JU6   1JUJ   1YPV   2ONB   2RD8   2RDA   3EAW   3EBU   3ED7   3EDW   3EF9   3EGY   3EHI   3EJL   3GG5   3GH0   3GH2   3H9K   3HB8   3N5E   3N5G   3OB7   4E28   4FGT   4G2O   4G6W   4GD7   4GYH   4H1I   4JEF   4KPW   4O1U   4O1X   4UP1   5HS3  

Gene RIF (527)

PMID Text
26745074 Thymidylate Synthase Polymorphisms are associated with the Risk of Lung Cancer.
26740498 treatment response, survival, and the associations between KRAS mutation status and tumour expression levels of BRCA1, TYMS and SRC retrospectively in a cohort of patients with non-small cell lung cancer, were evaluated.
26663950 High expression level of TS might be negative prognostic factor for resected NSCLC patients.
26502926 TYMS overexpression was detected in 61 % of non-small cell lung cancer patients and low expression in 39 %.
26416450 Study suggests a novel function of HSP90-Src pathway in regulation of TYMS expression and acquisition of 5-FU resistance in colon cancer.
26242737 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26220094 TYMS gene amplification predicts outcome of patients receiving pemetrexed with advanced non-small cell lung cancer.
26189437 The study suggests that patients carrying rs183205964, a G>C substitution in the promoter enhancer region of TYMS, are at strongly increased risk of severe, potentially life-threatening, toxicity when treated with fluoropyrimidines.
26142736 TS expression level was reduced more in dMMR cells after irinotecan treatment (p < 0.05). Our study favors an increased sensitivity of irinotecan in colon cancer with dMMR status
26108995 SAHA and 5-FU act synergistically to inhibit cell growth and tumorigenicity in Hepatocellular carcinoma via the induction of cell-cycle arrest and apoptosis through a mechanism involving the inhibition of thymidylate synthase
More...

AA Sequence

MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE      1 - 70
FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR     71 - 140
HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC    141 - 210
QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR    211 - 280
ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV                                         281 - 313
//

Text Mined References (488)

PMID Year Title
26745074 2015 Thymidylate Synthase Polymorphisms and Risk of Lung Cancer among the Jordanian Population: a Case Control Study.
26740498 2016 Poor response to platinum-based chemotherapy is associated with KRAS mutation and concomitant low expression of BRAC1 and TYMS in NSCLC.
26663950 2015 Expression of Ribonucleotide Reductase Subunit-2 and Thymidylate Synthase Correlates with Poor Prognosis in Patients with Resected Stages I-III Non-Small Cell Lung Cancer.
26502926 2015 Thymidylate synthase expression as a predictive biomarker of pemetrexed sensitivity in advanced non-small cell lung cancer.
26416450 2015 Acquired resistance to 5-fluorouracil via HSP90/Src-mediated increase in thymidylate synthase expression in colon cancer.
26242737 2015 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26220094 2016 Thymidylate synthase gene amplification predicts pemetrexed resistance in patients with advanced non-small cell lung cancer.
26189437 2016 Increased risk of severe fluoropyrimidine-associated toxicity in patients carrying a G to C substitution in the first 28-bp tandem repeat of the thymidylate synthase 2R allele.
26142736 2015 Association between mismatch repair gene and irinotecan-based chemotherapy in metastatic colon cancer.
26108995 2015 Suberoylanilide hydroxamic acid enhances chemosensitivity to 5-fluorouracil in hepatocellular carcinoma via inhibition of thymidylate synthase.
More...