Property Summary

Ligand Count 289
NCBI Gene PubMed Count 511
PubMed Score 732.02
PubTator Score 609.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (34)

Disease log2 FC p
adrenocortical carcinoma 1.973 5.0e-04
adult high grade glioma 2.000 2.1e-04
Astrocytoma, Pilocytic 1.200 5.0e-05
Atopic dermatitis 1.400 2.6e-05
atypical teratoid / rhabdoid tumor 3.800 6.1e-11
Breast cancer 1.100 7.4e-07
breast carcinoma 1.900 7.9e-06
cystic fibrosis and chronic rhinosinusit... 1.229 6.4e-03
Down syndrome 1.300 3.3e-03
ductal carcinoma in situ 1.500 1.6e-03
Endometriosis 2.110 2.0e-02
ependymoma 2.100 6.5e-08
fibroadenoma 1.200 2.0e-02
glioblastoma 2.800 6.1e-11
group 3 medulloblastoma 3.800 3.8e-07
interstitial cystitis 1.300 3.0e-02
intraductal papillary-mucinous carcinoma... 2.100 7.2e-03
intraductal papillary-mucinous neoplasm ... 2.200 2.3e-02
invasive ductal carcinoma 1.800 1.1e-03
lung adenocarcinoma 1.200 4.1e-09
lung cancer 2.500 2.2e-04
medulloblastoma, large-cell 4.300 9.5e-08
nasopharyngeal carcinoma 1.200 7.0e-05
non-small cell lung cancer 2.370 1.1e-26
ovarian cancer 1.200 3.1e-02
pancreatic cancer 1.100 1.4e-04
Pick disease -1.400 9.9e-03
pituitary cancer 1.400 2.2e-03
primary Sjogren syndrome 1.700 4.6e-04
primitive neuroectodermal tumor 3.900 1.2e-07
progressive supranuclear palsy -1.600 3.8e-02
psoriasis 1.200 2.6e-32
tuberculosis 1.400 1.4e-04
Waldenstrons macroglobulinemia 1.992 1.7e-02

Gene RIF (554)

AA Sequence

MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE      1 - 70
FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR     71 - 140
HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC    141 - 210
QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR    211 - 280
ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV                                         281 - 313
//

Text Mined References (517)

PMID Year Title