Property Summary

NCBI Gene PubMed Count 483
PubMed Score 722.73
PubTator Score 609.54

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.85195655171943E-13
glioblastoma 5572 3.09061940001399E-13
psoriasis 6685 9.44787284668791E-12
nasopharyngeal carcinoma 1056 3.9625644935683E-9
lung adenocarcinoma 2714 5.18028794745952E-8
medulloblastoma, large-cell 6234 9.49150452637952E-8
primitive neuroectodermal tumor 3031 1.2910152025974E-7
posterior fossa group A ependymoma 1511 3.43437854509307E-7
group 3 medulloblastoma 2254 3.82416370164868E-7
adrenocortical carcinoma 1427 4.0435385697593E-7
pediatric high grade glioma 2712 4.56247210590795E-7
Breast cancer 3099 6.96917206709675E-7
lung cancer 4473 1.03618800656097E-6
breast carcinoma 1614 7.93198282953766E-6
pilocytic astrocytoma 3086 2.23939171150044E-5
Atopic dermatitis 944 2.58759176325587E-5
tuberculosis 1563 6.4293281738916E-5
pancreatic cancer 2300 1.35967698907863E-4
ovarian cancer 8492 1.52428521029278E-4
primary Sjogren syndrome 789 4.58994473390379E-4
ductal carcinoma in situ 1745 8.89834577928229E-4
pituitary cancer 1972 0.00220727242586514
invasive ductal carcinoma 2950 0.00309025148226761
Down syndrome 548 0.00332228618266334
cystic fibrosis and chronic rhinosinusitis 213 0.0063688694852184
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00716180484092722
Pick disease 1893 0.00993336213699514
Endometriosis 535 0.0137898272283841
interstitial cystitis 2299 0.0153534545914132
Waldenstrons macroglobulinemia 765 0.01676716483627
fibroadenoma 557 0.0200616393334664
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0234936728040341
progressive supranuclear palsy 674 0.0378822799429107
Disease Target Count Z-score Confidence
Cancer 2346 5.717 2.9
Diarrhea 155 3.584 1.8
Neutropenia 78 3.227 1.6



Accession P04818 Q8WYK3 Q8WYK4 TS
Symbols TS


PANTHER Protein Class (2)


1HVY   1HW3   1HW4   1HZW   1I00   1JU6   1JUJ   1YPV   2ONB   2RD8   2RDA   3EAW   3EBU   3ED7   3EDW   3EF9   3EGY   3EHI   3EJL   3GG5   3GH0   3GH2   3H9K   3HB8   3N5E   3N5G   3OB7   4E28   4FGT   4G2O   4G6W   4GD7   4GYH   4H1I   4JEF   4KPW   4O1U   4O1X   4UP1   5HS3  

  Ortholog (16)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (527)

26745074 Thymidylate Synthase Polymorphisms are associated with the Risk of Lung Cancer.
26740498 treatment response, survival, and the associations between KRAS mutation status and tumour expression levels of BRCA1, TYMS and SRC retrospectively in a cohort of patients with non-small cell lung cancer, were evaluated.
26663950 High expression level of TS might be negative prognostic factor for resected NSCLC patients.
26502926 TYMS overexpression was detected in 61 % of non-small cell lung cancer patients and low expression in 39 %.
26416450 Study suggests a novel function of HSP90-Src pathway in regulation of TYMS expression and acquisition of 5-FU resistance in colon cancer.
26242737 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26220094 TYMS gene amplification predicts outcome of patients receiving pemetrexed with advanced non-small cell lung cancer.
26189437 The study suggests that patients carrying rs183205964, a G>C substitution in the promoter enhancer region of TYMS, are at strongly increased risk of severe, potentially life-threatening, toxicity when treated with fluoropyrimidines.
26142736 TS expression level was reduced more in dMMR cells after irinotecan treatment (p < 0.05). Our study favors an increased sensitivity of irinotecan in colon cancer with dMMR status
26108995 SAHA and 5-FU act synergistically to inhibit cell growth and tumorigenicity in Hepatocellular carcinoma via the induction of cell-cycle arrest and apoptosis through a mechanism involving the inhibition of thymidylate synthase

AA Sequence

ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV                                         281 - 313

Text Mined References (488)

PMID Year Title
26745074 2015 Thymidylate Synthase Polymorphisms and Risk of Lung Cancer among the Jordanian Population: a Case Control Study.
26740498 2016 Poor response to platinum-based chemotherapy is associated with KRAS mutation and concomitant low expression of BRAC1 and TYMS in NSCLC.
26663950 2015 Expression of Ribonucleotide Reductase Subunit-2 and Thymidylate Synthase Correlates with Poor Prognosis in Patients with Resected Stages I-III Non-Small Cell Lung Cancer.
26502926 2015 Thymidylate synthase expression as a predictive biomarker of pemetrexed sensitivity in advanced non-small cell lung cancer.
26416450 2015 Acquired resistance to 5-fluorouracil via HSP90/Src-mediated increase in thymidylate synthase expression in colon cancer.
26242737 2015 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26220094 2016 Thymidylate synthase gene amplification predicts pemetrexed resistance in patients with advanced non-small cell lung cancer.
26189437 2016 Increased risk of severe fluoropyrimidine-associated toxicity in patients carrying a G to C substitution in the first 28-bp tandem repeat of the thymidylate synthase 2R allele.
26142736 2015 Association between mismatch repair gene and irinotecan-based chemotherapy in metastatic colon cancer.
26108995 2015 Suberoylanilide hydroxamic acid enhances chemosensitivity to 5-fluorouracil in hepatocellular carcinoma via inhibition of thymidylate synthase.