Property Summary

NCBI Gene PubMed Count 62
Grant Count 1
Funding $114,000
PubMed Score 16.54
PubTator Score 23.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Testicular germ cell cancer 1 3.332 1.7

Expression

Gene RIF (37)

PMID Text
26499396 a novel fusion transcript comprising the RLN1 and RLN2 genes, was identified.
26272327 Serum concentrations of relaxin showed a positive association to duration of gestation among women with miscarriage but no association to duration of gestation among women with spontaneous onset of labour.
25322737 Although serum relaxin level is not a causative factor for benign hypermobility syndrome, the significant increases in patients with hyperkyphosis and pes planus suggest the hypothesis that relaxin has a limited and indefinite role in patients with BJHS.
24643989 Rln enhanced synergistically BMP-2-induced osteoblast differentiation and bone formation.
24640563 For the first time, we bring together the systemic (ovarian) and autocrine/paracrine (intrauterine) sources of RLN, in an attempt to understand how RLN contributes to premature birth in women.
24640561 Relaxin actions in pregnancy include increasing cervical pro-MMP-1 and pro-MMP-3 and decreasing TIMP-1, changes which soften the cervix.
23748429 Recombinant human relaxin (RLX) may provide a novel therapy to manage atrial fibrillation in humans by reversing fibrosis and hypertrophy and by modulating cardiac ionic currents.
23704950 Notch signaling can down-regulate TGF-beta1/Smad3-induced fibroblast-myofibroblast transition and that RLX could exert its well known anti-fibrotic action through the up-regulation of this pathway.
23661525 relaxin may promote the proliferation, invasion and metastasis of osteosarcoma cells by regulating the expression of MMP-9 and facilitating ECM degradation.
22180889 [review] This study not only clarifies the role of relaxin in sperm, but could also open avenues of research into its use in fertility treatment.
More...

AA Sequence

MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA      1 - 70
EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEA     71 - 140
ADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC                             141 - 185
//

Text Mined References (62)

PMID Year Title
26499396 2016 Identification of a novel fusion transcript between human relaxin-1 (RLN1) and human relaxin-2 (RLN2) in prostate cancer.
26272327 2015 Physical fitness, serum relaxin and duration of gestation.
25322737 2015 Serum relaxin levels in benign hypermobility syndrome.
24643989 2014 Relaxin augments BMP-2-induced osteoblast differentiation and bone formation.
24640563 2013 Relaxin and preterm birth.
24640561 2013 Relaxin and the control of primate parturition.
23748429 2013 Relaxin suppresses atrial fibrillation by reversing fibrosis and myocyte hypertrophy and increasing conduction velocity and sodium current in spontaneously hypertensive rat hearts.
23704950 2013 Relaxin prevents cardiac fibroblast-myofibroblast transition via notch-1-mediated inhibition of TGF-?/Smad3 signaling.
23661525 2013 RNAi-mediated knockdown of relaxin decreases in vitro proliferation and invasiveness of osteosarcoma MG-63 cells by inhibition of MMP-9.
22698078 2012 Relaxin, insulin and diabetes: an intriguing connection.
More...