Property Summary

NCBI Gene PubMed Count 64
PubMed Score 17.84
PubTator Score 23.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Hypertrophy 17 0.0 0.0

Expression

Gene RIF (39)

AA Sequence

MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA      1 - 70
EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEA     71 - 140
ADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC                             141 - 185
//

Text Mined References (64)

PMID Year Title