Property Summary

NCBI Gene PubMed Count 956
Grant Count 512
R01 Count 320
Funding $58,552,531.74
PubMed Score 3553.50
PubTator Score 2390.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis -2.100 0.000
interstitial cystitis -2.900 0.003
psoriasis -2.200 0.000
gastric carcinoma -1.100 0.014
head and neck cancer and chronic obstruc... -4.000 0.027

Synonym

Accession P04798 A4F3V9 A4F3W0 Q53G18
Symbols AHH
AHRR
CP11
CYP1
CYPIA1
P1-450
P450-C
P450DX

Gene

PANTHER Protein Class (2)

PDB

4I8V  

Gene RIF (1100)

PMID Text
27090234 Data show a combined role of cytochrome P 450 1A1 (CYP1A1), Glutathione -S -transferase M1 (GSTM1) and T1 (GSTT1) polymorphisms and smoking status can be attributed for the cause of lung cancer.
26881514 CYP1A1 2454A > G polymorphism is associated with colorectal cancer risk.
26838244 No statistically significant overall association was found between breast cancer risk and CYP1A1 M2 genotypes.
26798414 the association of CYP1A1 M1 (rs4646903) and COMT (rs4680) polymorphisms in 130 cervical cancer cases (c-cancer) and 179 controls, is reported.
26782595 The CYP1A1 gene deletion is a lung cancer risk factor, and interacts with smoking in non-small cell lung cancer development.
26782562 CYP1A1 and GSTM1 gene polymorphisms affect familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782546 A significant association between the frequency of the CYP1A1 polymorphism and the development of cervical cancer.
26782431 polymorphisms in CYP2E1 (PstI) and CYP1A1 (MspI) were not associated with sporadic colorectal cancer in the evaluated Brazilian population.
26681006 The allelic variation frequency of the CYP1A1 gene at exon 7 (Ile 462 Val) in bone tumor patients was significantly higher than that in control.
26643992 CYP1A1 expression in 3D spheroids of liver cancer cells is regulated by AhR and PXR.
More...

AA Sequence

MLFPISMSATEFLLASVIFCLVFWVIRASRPQVPKGLKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQQY      1 - 70
GDVLQIRIGSTPVVVLSGLDTIRQALVRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQN     71 - 140
GLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHN    141 - 210
HQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRD    211 - 280
ITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV    281 - 350
IGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKL    351 - 420
WVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQRVEFSVPLGVKVDM    421 - 490
TPIYGLTMKHACCEHFQMQLRS                                                    491 - 512
//

Text Mined References (959)

PMID Year Title
27090234 2016 Association of CYP1A1, GSTM1 and GSTT1 gene polymorphisms with risk of non-small cell lung cancer in Andhra Pradesh region of South India.
26881514 Association between CYP1A1 2454A > G polymorphism and colorectal cancer risk: A meta-analysis.
26838244 2016 Lack of Association between CYP1A1 M2 and M4 Polymorphisms and Breast Carcinoma in Jordanian Women: a Case-Control Study.
26798414 2016 Epistatic Interaction of CYP1A1 and COMT Polymorphisms in Cervical Cancer.
26782595 2016 Interaction of the CYP1A1 gene polymorphism and smoking in non-small cell lung cancer susceptibility.
26782562 2015 Correlation of CYP1A1 and GSTM1 gene polymorphisms and environmental factors to familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782546 2015 Analysis of CYP1A1 and COMT polymorphisms in women with cervical cancer.
26782431 2015 A case-control study of CYP2E1 (PstI) and CYP1A1 (MspI) polymorphisms in colorectal cancer.
26681006 2015 Effect of CYP1A1 and GSTM1 genetic polymorphisms on bone tumor susceptibility.
26643992 2015 CYP1A1 and CYP1A2 expression levels are differentially regulated in three-dimensional spheroids of liver cancer cells compared to two-dimensional monolayer cultures.
More...