Property Summary

Ligand Count 13
NCBI Gene PubMed Count 1,013
PubMed Score 3641.53
PubTator Score 2390.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
gastric carcinoma -1.100 1.4e-02
head and neck cancer and chronic obstruc... -4.000 2.7e-02
interstitial cystitis -2.900 2.7e-03
psoriasis -1.300 4.4e-02
tuberculosis -2.100 1.2e-05

Gene RIF (1156)

AA Sequence

MLFPISMSATEFLLASVIFCLVFWVIRASRPQVPKGLKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQQY      1 - 70
GDVLQIRIGSTPVVVLSGLDTIRQALVRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQN     71 - 140
GLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHN    141 - 210
HQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRD    211 - 280
ITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV    281 - 350
IGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKL    351 - 420
WVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQRVEFSVPLGVKVDM    421 - 490
TPIYGLTMKHACCEHFQMQLRS                                                    491 - 512
//

Text Mined References (1016)

PMID Year Title