Property Summary

Ligand Count 7
NCBI Gene PubMed Count 417
PubMed Score 974.92
PubTator Score 1299.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 3.675 1.8
Charcot-Marie-Tooth disease 62 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.644 2.5e-02
adrenocortical carcinoma 1.233 1.3e-03
Breast cancer 1.500 3.4e-05
colon cancer -1.300 1.9e-02
cystic fibrosis -1.706 4.5e-06
diabetes mellitus -1.100 2.9e-03
ependymoma 1.100 4.7e-05
esophageal adenocarcinoma -1.800 2.0e-02
glioblastoma 1.900 1.2e-02
group 4 medulloblastoma -1.600 2.3e-03
lung adenocarcinoma 1.458 1.5e-06
ovarian cancer -1.200 7.2e-03
pancreatic cancer 1.400 4.4e-03
pancreatic ductal adenocarcinoma liver m... 1.657 4.8e-02
Rheumatoid arthritis -1.100 1.1e-02
subependymal giant cell astrocytoma 1.898 3.3e-02
ulcerative colitis -1.400 1.7e-06

Gene RIF (341)

AA Sequence

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA      1 - 70
PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR     71 - 140
KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK         141 - 205
//

Text Mined References (436)

PMID Year Title