Property Summary

NCBI Gene PubMed Count 379
Grant Count 535
R01 Count 351
Funding $59,189,543.41
PubMed Score 939.23
PubTator Score 1299.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.011
esophageal adenocarcinoma -1.800 0.020
glioblastoma 1.900 0.012
posterior fossa group A ependymoma 1.300 0.000
cystic fibrosis -1.706 0.000
adrenocortical carcinoma 1.233 0.001
pancreatic ductal adenocarcinoma liver m... 1.657 0.048
colon cancer -1.300 0.019
active Crohn's disease -1.644 0.025
diabetes mellitus -1.100 0.003
group 4 medulloblastoma -1.600 0.002
subependymal giant cell astrocytoma 1.898 0.033
lung adenocarcinoma 1.458 0.000
Breast cancer 1.500 0.000
ulcerative colitis -1.400 0.000
ovarian cancer 3.300 0.000
pancreatic cancer 1.400 0.004

Synonym

Accession P04792 B2R4N8 Q6FI47 Q96C20 Q96EI7 Q9UC31 Q9UC34 Q9UC35 Q9UC36 HspB1
Symbols CMT2F
HMN2B
HSP27
HSP28
Hsp25
SRP27
HS.76067
HEL-S-102

Gene

PANTHER Protein Class (1)

PDB

2N3J   3Q9P   3Q9Q   4MJH  

Gene RIF (306)

PMID Text
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
26867010 FXa inhibitor reduces the collagen-stimulated release of phosphorylated HSP27 from human platelets due to the inhibition of HSP27 phosphorylation via p44/p42 MAP kinase
26859835 role in myofibroblast differentiation and development of pulmonary fibrosis
26805817 Phosphorylated HSP27 could be a potentially useful biomarker that predicts the sensitivity of pancreatic cancer to gemcitabine-based chemotherapy.
26782567 Three of the differentially expressed heat-schock proteins, HSP90A, HSPB1, and HSPB2, are up-regulated in giant cell tumor of bone patients.
26744531 In clinical specimens of non-small cell lung cancer, HSPB1 expression was absent from tumor endothelial cells undergoing the endothelial-to-mesenchymal transition
26739047 The authors now show that human cytomegalovirus more robustly upregulated Mcl-1 than normal myeloid growth factors and that Mcl-1 was the only myeloid survival factor to rapidly induce HSP27 prior to the 48-h cell fate checkpoint.
26694816 HSPB1 was expressed in blood vessels but scarcely in the parenchyma in patient with multiple sclerosis
26648539 The present study investigated the effects of small hairpin (sh)RNA-mediated HSP27 knockdown on the anticancer effects of quercetin in U937 human leukemia cells.
26627832 Hsp27-Ubc9 pathway recognizes the conformation of mutant CFTR which leads to its SUMO-2 conjugation and degradation by the ubiquitin-proteasome system.
More...

AA Sequence

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA      1 - 70
PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR     71 - 140
KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK         141 - 205
//

Text Mined References (395)

PMID Year Title
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
26867010 2016 Factor Xa Inhibitor Suppresses the Release of Phosphorylated HSP27 from Collagen-Stimulated Human Platelets: Inhibition of HSP27 Phosphorylation via p44/p42 MAP Kinase.
26859835 2016 Heat Shock Protein 27 Plays a Pivotal Role in Myofibroblast Differentiation and in the Development of Bleomycin-Induced Pulmonary Fibrosis.
26805817 2016 The Clinical Significance of Phosphorylated Heat Shock Protein 27 (HSPB1) in Pancreatic Cancer.
26782567 2015 Potential role of heat-shock proteins in giant cell tumors.
26744531 2016 HSPB1 Inhibits the Endothelial-to-Mesenchymal Transition to Suppress Pulmonary Fibrosis and Lung Tumorigenesis.
26739047 2016 Human Cytomegalovirus Stimulates the Synthesis of Select Akt-Dependent Antiapoptotic Proteins during Viral Entry To Promote Survival of Infected Monocytes.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
26648539 2016 Suppression of HSP27 increases the anti?tumor effects of quercetin in human leukemia U937 cells.
26627832 2016 Non-native Conformers of Cystic Fibrosis Transmembrane Conductance Regulator NBD1 Are Recognized by Hsp27 and Conjugated to SUMO-2 for Degradation.
More...