Property Summary

NCBI Gene PubMed Count 44
Grant Count 5
R01 Count 5
Funding $362,906
PubMed Score 800.94
PubTator Score 53.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.010

Synonym

Accession P04746 B9EJG1 Q9UBH3 PA
Symbols PA
AMY2

Gene

PANTHER Protein Class (2)

PDB

1B2Y   1BSI   1CPU   1HNY   1KB3   1KBB   1KBK   1KGU   1KGW   1KGX   1U2Y   1U30   1U33   1XCW   1XCX   1XD0   1XD1   1XGZ   1XH0   1XH1   1XH2   2CPU   2QMK   2QV4   3BAI   3BAJ   3BAK   3BAW   3BAX   3BAY   3CPU   3IJ7   3IJ8   3IJ9   3OLD   3OLE   3OLG   3OLI   4GQQ   4GQR   4W93   4X9Y   5E0F   5EMY  

Gene RIF (9)

PMID Text
26335011 Data show that amylase-alpha2A autoantibodies may help to diagnosis of autoimmune pancreatitis (AIP) and to differentiate AIP subtypes.
22584580 Mammalian pancreatic alpha-amylases share a common carbohydrate binding activity and specifically bind to the intestinal brush border.
21366335 Studies indicate that chloride activates alpha-amylases and ACE, and gaining insight into the potential mechanisms by which chloride functions in PSII.
20428766 We demonstrated that AMY2A is frequently silenced in gastric carcinoma deletion 1p21.1.
19001184 Autoantibody against amylase alpha-2A is a novel diagnostic marker for both autoimmune pancreatitis and fulminant type 1 diabetes.
16152770 Observational study of genotype prevalence. (HuGE Navigator)
15648851 Observational study of genotype prevalence. (HuGE Navigator)
15571103 Observational study of genotype prevalence. (HuGE Navigator)
15304511 A new approach for the discovery and subsequent structural elucidation of oligosaccharide-based inhibitors of alpha-amylases based upon autoglucosylation of known alpha-glucosidase inhibitors is presented.

AA Sequence

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPF      1 - 70
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD     71 - 140
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR    141 - 210
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV    211 - 280
IRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF    281 - 350
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP    351 - 420
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA    421 - 490
HFSISNSAEDPFIAIHAESKL                                                     491 - 511
//

Text Mined References (44)

PMID Year Title
26335011 2015 Role of Amylase-?2A Autoantibodies in the Diagnosis of Autoimmune Pancreatitis.
24707315 2013 The Role of Copy Number Variation in African Americans with Type 2 Diabetes-Associated End Stage Renal Disease.
24365473 2013 An association-adjusted consensus deleterious scheme to classify homozygous Mis-sense mutations for personal genome interpretation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22584580 2012 Functional regulation of sugar assimilation by N-glycan-specific interaction of pancreatic ?-amylase with glycoproteins of duodenal brush border membrane.
21879258 2012 Dickkopf-3 maintains the PANC-1 human pancreatic tumor cells in a dedifferentiated state.
21366335 2011 Chloride regulation of enzyme turnover: application to the role of chloride in photosystem II.
20428766 2010 AMY2A: a possible tumor-suppressor gene of 1p21.1 loss in gastric carcinoma.
20142997 2010 Comparison of lung cancer cell lines representing four histopathological subtypes with gene expression profiling using quantitative real-time PCR.
More...