Property Summary

NCBI Gene PubMed Count 18
Grant Count 28
R01 Count 7
Funding $8,186,460
PubMed Score 170.62
PubTator Score 4.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25588701 Diurnal and stress-response salivary alpha amylase patterns were related to child adiposity: decreased morning alpha amylase was associated with increased BMI.
22063648 results show a strong association between acute physical stressor-induced elevations in sAA levels and patients with MDD.
21827821 These findings confirm that sAA is sensitive to the effects of potentially stressful stimuli (state variance) and at the same time demonstrate its relative robustness and stability across time and conditions (trait variance).

AA Sequence

MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF      1 - 70
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD     71 - 140
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFR    141 - 210
IDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV    211 - 280
IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF    281 - 350
TRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP    351 - 420
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA    421 - 490
HFSISNSAEDPFIAIHAESKL                                                     491 - 511
//

Text Mined References (27)

PMID Year Title
25588701 2015 Salivary alpha amylase diurnal pattern and stress response are associated with body mass index in low-income preschool-aged children.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22063648 2012 Salivary alpha-amylase and cortisol responsiveness following electrical stimulation stress in major depressive disorder patients.
21827821 2011 State and trait variance in salivary ?-amylase: a behavioral genetic study.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...