Property Summary

NCBI Gene PubMed Count 33
PubMed Score 15.14
PubTator Score 8.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.190 2.5e-02
acute quadriplegic myopathy 1.592 2.1e-09
adrenocortical carcinoma -1.054 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 5.8e-04
Breast cancer -1.100 1.3e-06
colon cancer -1.700 4.3e-06
cystic fibrosis 1.185 1.4e-04
Down syndrome 1.200 2.5e-02
Endometriosis -2.297 2.1e-02
group 3 medulloblastoma -1.700 1.4e-03
intraductal papillary-mucinous adenoma (... -1.100 3.4e-02
intraductal papillary-mucinous carcinoma... -1.800 3.6e-02
intraductal papillary-mucinous neoplasm ... -2.300 1.0e-02
invasive ductal carcinoma -1.034 4.7e-02
lung cancer -1.200 5.8e-03
lung carcinoma 1.900 2.9e-17
malignant mesothelioma -2.900 2.4e-08
medulloblastoma, large-cell -1.300 2.6e-02
mucosa-associated lymphoid tissue lympho... 1.130 3.0e-02
nephrosclerosis -1.099 5.7e-04
non-small cell lung cancer -1.206 1.5e-08
osteosarcoma 1.292 9.3e-05
ovarian cancer 1.700 1.7e-05
pancreatic cancer -1.200 2.5e-05
Pick disease 1.200 3.1e-03
primary pancreatic ductal adenocarcinoma -2.170 1.3e-03
psoriasis -1.100 8.5e-03
tuberculosis -1.100 1.8e-02
ulcerative colitis -2.600 3.4e-09

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD               1 - 61
//

Text Mined References (34)

PMID Year Title