Property Summary

NCBI Gene PubMed Count 33
PubMed Score 13.96
PubTator Score 8.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04733 Q9UI97 MT-1F
Symbols MT1

Gene

Gene RIF (12)

PMID Text
24440467 we found that metallothionein expression induced by Cd occurred much later, with the expression seen at least 12h or more after the Nrf2-dependent immediate responses were almost completed.
23536959 Aortic protection in diabetes by zinc supplementation is associated with upregulation of both metallothionein and Nrf2 expression.
23332881 Metallothionein may have a role in the control of apoptosis in pleomorphic adenoma.
23064051 findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type; upregulated MT-1F expression associated with larger primary tumor size and higher grade of malignanacy
22426038 MT1F is a putative tumor suppressor gene in colon carcinogenesis that is downregulated mainly by loss of heterozygosity in colon cancer tissue
21820154 This study identifies for the first time the relevant metallothionein isoforms for colorectal cancer progression.
21409206 Studies provide the mechanistic properties of metal binding for metallothionein metallation.
21128001 MT-1 rs8052394 A allele is associated with oral squamous cell carcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
19251948 Knockdown of MT1F gene increased particular matter(2.5)-induced H2O2 release in alveolar macrophages.
More...

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD               1 - 61
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24440467 2014 Significance of the rapid increase in GSH levels in the protective response to cadmium exposure through phosphorylated Nrf2 signaling in Jurkat T-cells.
23536959 2013 Zinc protects against diabetes-induced pathogenic changes in the aorta: roles of metallothionein and nuclear factor (erythroid-derived 2)-like 2.
23332881 2013 Immunohistochemical expression of metallothionein in pleomorphic adenoma of minor salivary glands: a role in the control of apoptosis?
23064051 2013 Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22426038 2012 Downregulation of metallothionein 1F, a putative oncosuppressor, by loss of heterozygosity in colon cancer tissue.
21820154 2012 Metallothionein expression in colorectal cancer: relevance of different isoforms for tumor progression and patient survival.
21409206 2011 The "magic numbers" of metallothionein.
21269460 2011 Initial characterization of the human central proteome.
More...