Property Summary

NCBI Gene PubMed Count 33
PubMed Score 13.96
PubTator Score 8.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.92853976606601E-17
non-small cell lung cancer 2798 1.03610517489445E-11
ulcerative colitis 2087 3.76075706072286E-9
acute quadriplegic myopathy 1157 9.36636949838052E-9
colon cancer 1475 8.62666705233908E-8
malignant mesothelioma 3163 3.42875902715208E-7
atypical teratoid/rhabdoid tumor 1095 3.71959508175918E-7
ovarian cancer 8492 6.53956122641603E-6
sonic hedgehog group medulloblastoma 1482 1.42593609747053E-5
osteosarcoma 7933 9.29257778359435E-5
lung cancer 4473 1.10876101019971E-4
cystic fibrosis 1670 1.44588387099627E-4
tuberculosis and treatment for 6 months 686 3.86476487344406E-4
nephrosclerosis 329 5.74656961611943E-4
pancreatic cancer 2300 0.00121591115774751
primary pancreatic ductal adenocarcinoma 1271 0.00183247610614653
medulloblastoma, large-cell 6234 0.00191291525900036
inflammatory breast cancer 404 0.00305507817539949
Pick disease 1893 0.00308702766365913
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00396410635812995
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00817830839534073
psoriasis 6685 0.00849489774180033
adrenocortical carcinoma 1427 0.0167019872951423
active Crohn's disease 918 0.0196865615790991
Endometriosis 535 0.0199353173133968
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.022695733142933
Down syndrome 548 0.0248518074865054
mucosa-associated lymphoid tissue lymphoma 480 0.0301152644085877
invasive ductal carcinoma 2950 0.0465840415417586

Expression

Synonym

Accession P04733 Q9UI97 MT-1F
Symbols MT1

Gene

Gene RIF (12)

PMID Text
24440467 we found that metallothionein expression induced by Cd occurred much later, with the expression seen at least 12h or more after the Nrf2-dependent immediate responses were almost completed.
23536959 Aortic protection in diabetes by zinc supplementation is associated with upregulation of both metallothionein and Nrf2 expression.
23332881 Metallothionein may have a role in the control of apoptosis in pleomorphic adenoma.
23064051 findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type; upregulated MT-1F expression associated with larger primary tumor size and higher grade of malignanacy
22426038 MT1F is a putative tumor suppressor gene in colon carcinogenesis that is downregulated mainly by loss of heterozygosity in colon cancer tissue
21820154 This study identifies for the first time the relevant metallothionein isoforms for colorectal cancer progression.
21409206 Studies provide the mechanistic properties of metal binding for metallothionein metallation.
21128001 MT-1 rs8052394 A allele is associated with oral squamous cell carcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
19251948 Knockdown of MT1F gene increased particular matter(2.5)-induced H2O2 release in alveolar macrophages.
More...

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD               1 - 61
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24440467 2014 Significance of the rapid increase in GSH levels in the protective response to cadmium exposure through phosphorylated Nrf2 signaling in Jurkat T-cells.
23536959 2013 Zinc protects against diabetes-induced pathogenic changes in the aorta: roles of metallothionein and nuclear factor (erythroid-derived 2)-like 2.
23332881 2013 Immunohistochemical expression of metallothionein in pleomorphic adenoma of minor salivary glands: a role in the control of apoptosis?
23064051 2013 Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22426038 2012 Downregulation of metallothionein 1F, a putative oncosuppressor, by loss of heterozygosity in colon cancer tissue.
21820154 2012 Metallothionein expression in colorectal cancer: relevance of different isoforms for tumor progression and patient survival.
21409206 2011 The "magic numbers" of metallothionein.
21269460 2011 Initial characterization of the human central proteome.
More...