Property Summary

NCBI Gene PubMed Count 29
PubMed Score 41.59
PubTator Score 146.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 2.238 3.2e-09
adrenocortical carcinoma -1.122 7.2e-03
atypical teratoid / rhabdoid tumor -2.400 3.0e-05
Breast cancer -1.400 1.4e-06
breast carcinoma -1.100 9.0e-05
colon cancer -1.800 8.9e-06
Down syndrome 1.300 1.1e-02
Endometriosis -2.148 3.1e-02
facioscapulohumeral dystrophy -1.900 3.0e-02
group 3 medulloblastoma -2.700 2.1e-05
intraductal papillary-mucinous adenoma (... -1.300 2.3e-02
intraductal papillary-mucinous carcinoma... -1.800 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.700 7.9e-03
lung adenocarcinoma -1.800 4.0e-07
lung cancer -2.600 2.0e-05
malignant mesothelioma -6.700 4.5e-10
medulloblastoma, large-cell -3.200 4.5e-05
non-small cell lung cancer -1.935 7.1e-14
osteosarcoma 1.280 5.8e-03
ovarian cancer 1.800 7.3e-06
pancreatic cancer -1.100 2.0e-05
primary pancreatic ductal adenocarcinoma -1.573 1.8e-02
ulcerative colitis -2.000 1.3e-07

Gene RIF (9)

AA Sequence

MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA               1 - 61
//

Text Mined References (31)

PMID Year Title