Property Summary

NCBI Gene PubMed Count 29
Grant Count 22
R01 Count 18
Funding $2,392,753.22
PubMed Score 40.10
PubTator Score 146.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
22843066 MT1E can enhance the migration and invasion of human glioma cells by inducing MMP-9 inactivation via the upregulation of NF-kappaB p50.
21358552 Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes.
20848733 MT1E is a potential tumour suppressor gene, whose loss may promote resistance to apoptosis-inducing therapies.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
19420986 High frequency of hypermethylation of MT-1E was found in endometrial carcinomas.
18724390 analysis identified genes known to be associated with cell invasion such as versican, and novel ones, including metallothionein 1E (MT1E) and nicotinamide N-methyltransferase (NNMT)
18349110 Observational study of gene-disease association. (HuGE Navigator)
15747776 Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Heavy metal ion transporter activity.
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA               1 - 61
//

Text Mined References (31)

PMID Year Title
22843066 2012 Role of metallothionein 1E in the migration and invasion of human glioma cell lines.
21358552 2011 Profile of adipose tissue gene expression in premenopausal and postmenopausal women: site-specific differences.
20848733 2010 Metallothionein 1E is methylated in malignant melanoma and increases sensitivity to cisplatin-induced apoptosis.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
19420986 2009 Epigenetic alteration of the metallothionein 1E gene in human endometrial carcinomas.
18724390 2008 Overlapping gene expression profiles of cell migration and tumor invasion in human bladder cancer identify metallothionein 1E and nicotinamide N-methyltransferase as novel regulators of cell migration.
18349110 2008 Polymorphisms in metallothionein-1 and -2 genes associated with the risk of type 2 diabetes mellitus and its complications.
17244347 2007 Pathways and genes differentially expressed in the motor cortex of patients with sporadic amyotrophic lateral sclerosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16827180 2006 Metallothionein 1 isoform gene expression induced by cadmium in human peripheral blood lymphocytes.
More...