Property Summary

NCBI Gene PubMed Count 51
Grant Count 72
R01 Count 24
Funding $13,952,107.61
PubMed Score 735.95
PubTator Score 39.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.031 0.000
primary pancreatic ductal adenocarcinoma 1.388 0.002
diabetes mellitus 2.300 0.001
ovarian cancer 2.200 0.000
pancreatic cancer 1.300 0.003
dermatomyositis -1.500 0.001

Synonym

Accession P04632 A8K0P1 Q8WTX3 Q96EW0 CSS1
Symbols CANP
CDPS
CSS1
CANPS
CAPN4
CALPAIN4

Gene

PDB

1KFU   1KFX   4PHJ   4PHK   4PHM   4WQ2   4WQ3   5D69  

Gene RIF (20)

PMID Text
26771715 CAPNS1 depletion is coupled to impairment of breast cancer cell growth.
25636510 High levels of Capn4 expression were associated with lymph node metastasis and large tumor size in non-small cell lung cancer patients.Capn4 promotes non-small cell lung cancer progression via upregulation of matrix metalloproteinase 2.
25304384 HBXIP was able to up-regulate Capn4 at the levels of promoter.
24962955 Capn4 can contribute to hepatocellular carcinoma growth and metastasis
24703594 Capn4 upregulated MMP2 via nuclear factor-kappaB activation, manifested by increased phosphorylation of p65, a subunit of NF-kappaB.
24628706 The overexpression of Capn4 is a novel negative prognostic marker, and Capn4 may be used as a new target in therapeutic strategies for human glioma.
24514433 Capn4 mRNA and protein are increased in human clear cell renal cell carcinoma tissues and higher Capn4 levels are associated with advanced clinical tumour stage and shorter overall survival.
24297866 This study suggests that augmented calpain activity is associated with increased incidence of thrombosis under hypoxic environments.
23349941 Capn4 overexpression was implicated in ICC metastasis/invasion, and Capn4 overexpression may be used as a molecular therapeutic target for intrahepatic cholangiocarcinoma
21268016 The expression of both CAPN 1 and CAPNS 1 is increased in transplant kidneys with acute rejection, and increased expression of CAPN 1 alone was observed in kidneys with chronic rejection.
More...

AA Sequence

MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAIS      1 - 70
EAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFG     71 - 140
IDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLY    141 - 210
NMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS                211 - 268
//

Text Mined References (59)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26771715 2016 Calpain restrains the stem cells compartment in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25636510 2015 Capn4 promotes non-small cell lung cancer progression via upregulation of matrix metalloproteinase 2.
25416956 2014 A proteome-scale map of the human interactome network.
25304384 2014 The oncoprotein HBXIP enhances migration of breast cancer cells through increasing filopodia formation involving MEKK2/ERK1/2/Capn4 signaling.
24962955 2014 Capn4 contributes to tumour growth and metastasis of hepatocellular carcinoma by activation of the FAK-Src signalling pathways.
24703594 2014 Capn4 is a marker of poor clinical outcomes and promotes nasopharyngeal carcinoma metastasis via nuclear factor-?B-induced matrix metalloproteinase 2 expression.
24628706 2014 Increased expression of Capn4 is associated with the malignancy of human glioma.
24514433 2014 Capn4 mRNA level is correlated with tumour progression and clinical outcome in clear cell renal cell carcinoma.
More...