Property Summary

NCBI Gene PubMed Count 258
Grant Count 579
R01 Count 354
Funding $38,893,968.78
PubMed Score 1003.41
PubTator Score 875.59

Knowledge Summary

Patent (130,834)

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.400 0.007
psoriasis 1.200 0.000

Synonym

Accession P04629 B2R6T5 B7ZM34 P08119 Q15655 Q15656 Q5D056 Q5VZS2 Q7Z5C3 Q9UIU7
Symbols MTC
TRK
TRK1
TRKA
Trk-A
p140-TrkA

Gene

PDB

1HE7   1SHC   1WWA   1WWW   2IFG   4AOJ   4CRP   4F0I   4GT5   4PMM   4PMP   4PMS   4PMT   4YNE   4YPS  

Protein-protein Interaction (12)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (177)

PMID Text
26962689 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells
26863915 Report novel variant of myo/haemangiopericytic sarcoma with recurrent NTRK1 gene fusions.
26569118 NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid
26564979 Two key biological processes for progressive hearing loss, TrkA signaling pathway and EGF receptor signaling pathway were significantly and differentially enriched by the two sets of allele-specific target genes of miR-96.
26546295 Data show that p.G595R and p.G667C TRKA mutations drive acquired resistance to entrectinib in colorectal cancers carrying NTRK1 rearrangements.
26496938 TrkA as a candidate oncogene in malignant melanoma and support a model in which the NGF-TrkA-MAPK pathway may mediate a trade-off between neoplastic transformation and adaptive anti-proliferative response.
26446845 This work identifies GGA3 as a key player in a novel DXXLL-mediated endosomal sorting machinery that targets TrkA to the plasma membrane, where it prolongs the activation of Akt signaling and survival responses.
26408608 The percentage of p75NTR+ peripheral blood mononuclear cells increased in early stages of chronic obstructive pulmonary disease (I-II), while TrKA+ peripheral blood mononuclear cells increased in late stages (III-IV).
26001971 Translocations in the NTRK1 gene are recurring events in colorectal cancer, although occurring at a low frequency (around 0.5%).
25948268 TrkA expression in neurons was found to be regulated at the gene promoter level by Bex3 protein.
More...

AA Sequence

MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE      1 - 70
LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL     71 - 140
QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD    141 - 210
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQV    211 - 280
NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ    281 - 350
PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV    351 - 420
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHI    421 - 490
IENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE    491 - 560
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAV    561 - 630
ASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL    631 - 700
YRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQ    701 - 770
RHSIKDVHARLQALAQAPPVYLDVLG                                                771 - 796
//

Publication (260)

PMID Year Title
26962689 2016 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells.
26863915 2016 Paediatric and adult soft tissue sarcomas with NTRK1 gene fusions: a subset of spindle cell sarcomas unified by a prominent myopericytic/haemangiopericytic pattern.
26569118 2015 NGF Modulates trkANGFR/p75NTR in ?SMA-Expressing Conjunctival Fibroblasts from Human Ocular Cicatricial Pemphigoid (OCP).
26564979 2015 Knowledge-based analysis of functional impacts of mutations in microRNA seed regions.
26546295 2016 Acquired Resistance to the TRK Inhibitor Entrectinib in Colorectal Cancer.
26496938 2015 TrkA is amplified in malignant melanoma patients and induces an anti-proliferative response in cell lines.
26446845 2015 GGA3 mediates TrkA endocytic recycling to promote sustained Akt phosphorylation and cell survival.
26408608 2016 A role for NGF and its receptors TrKA and p75NTR in the progression of COPD.
26001971 2015 Chromosomal rearrangements involving the NTRK1 gene in colorectal carcinoma.
25948268 2015 Bex3 Dimerization Regulates NGF-Dependent Neuronal Survival and Differentiation by Enhancing trkA Gene Transcription.
More...