Property Summary

NCBI Gene PubMed Count 172
Grant Count 366
R01 Count 250
Funding $34,611,160.82
PubMed Score 492.73
PubTator Score 347.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04628 Q5U0N2
Symbols INT1
OI15
BMND16

Gene

PANTHER Protein Class (1)

Gene RIF (147)

PMID Text
26707142 our results suggest that miR-148a can suppress the migration and invasion of breast cancer cells by targeting WNT-1 and inhibiting Wnt/beta-catenin signaling pathway and this will provide new insights into the molecular mechanisms of breast cancer metastasis
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
26499380 High expression of WNT1 is associated with liver cancer.
26450645 IWR-1 has the potential to suppress tumor metastasis by inhibiting Wnt/beta-catenin pathway as well as survivin expression
26421711 MCF7 cells over-expressing both WNT1 and FGF3 show a 3.5-fold increase in mammosphere formation; conditioned media from these cells also promotes stem cell activity in untransfected parental MCF7 and T47D cells, as WNT1 and FGF3 are secreted factors.
26261683 Suggest that TGF-beta1/Smad and Wnt/CTNNB1 signaling pathways both contribute to pathological scar formation.
26214410 Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway.
25909283 Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling.
25721714 Wnt1 promotes CD36 expression via activation of PPAR-gamma and TCF4.
25677507 Agonists of epoxyeicosatrienoic acids reduce infarct size and ameliorate cardiac dysfunction via activation of HO-1 and Wnt1 canonical pathway.
More...

AA Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRR      1 - 70
LIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVA     71 - 140
RSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTV    141 - 210
FSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPA    211 - 280
HKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFH    281 - 350
WCCHVSCRNCTHTRVLHECL                                                      351 - 370
//

Publication (173)

PMID Year Title
26707142 2016 MicroRNA-148a inhibits breast cancer migration and invasion by directly targeting WNT-1.
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
26499380 2015 Overexpression of Klotho suppresses liver cancer progression and induces cell apoptosis by negatively regulating wnt/?-catenin signaling pathway.
26450645 2015 IWR-1 inhibits epithelial-mesenchymal transition of colorectal cancer cells through suppressing Wnt/?-catenin signaling as well as survivin expression.
26421711 2015 Mitochondrial mass, a new metabolic biomarker for stem-like cancer cells: Understanding WNT/FGF-driven anabolic signaling.
26261683 2015 Cross-talk between TGF-?/Smad pathway and Wnt/?-catenin pathway in pathological scar formation.
26214410 2015 Wnt1-induced MAFK expression promotes osteosarcoma cell proliferation.
26049140 2015 A WNT1-regulated developmental gene cascade prevents dopaminergic neurodegeneration in adult En1(+/-) mice.
25909283 2015 Fibulin-5 inhibits Wnt/?-catenin signaling in lung cancer.
25721714 2015 Wnt1 positively regulates CD36 expression via TCF4 and PPAR-? in macrophages.
More...