Property Summary

NCBI Gene PubMed Count 197
PubMed Score 516.83
PubTator Score 347.70

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (6)

Gene RIF (171)

AA Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRR      1 - 70
LIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVA     71 - 140
RSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTV    141 - 210
FSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPA    211 - 280
HKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFH    281 - 350
WCCHVSCRNCTHTRVLHECL                                                      351 - 370
//

Text Mined References (198)

PMID Year Title