Property Summary

Ligand Count 355
NCBI Gene PubMed Count 2,451
PubMed Score 20244.63
PubTator Score 16162.96

Knowledge Summary

Patent (1,084,968)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Neuroblastoma 80 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.300 1.3e-03
ductal carcinoma in situ 3.100 1.8e-02
ependymoma 2.300 2.2e-16
atypical teratoid / rhabdoid tumor 1.500 1.0e-03
breast carcinoma 1.100 1.0e-12
fibroadenoma 1.900 8.3e-03
interstitial cystitis -1.500 1.0e-03
intraductal papillary-mucinous adenoma (... 1.400 5.7e-04
invasive ductal carcinoma 2.700 4.4e-02
lung carcinoma -1.200 2.7e-19
pancreatic cancer 1.100 2.1e-04
pancreatic ductal adenocarcinoma liver m... 1.918 3.7e-02
ulcerative colitis -1.200 1.0e-04

 GWAS Trait (2)

Protein-protein Interaction (1)

Gene RIF (2378)

AA Sequence

MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNAS      1 - 70
LSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLREL     71 - 140
QLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE    141 - 210
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFE    211 - 280
SMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHL    281 - 350
REVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLP    351 - 420
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPH    421 - 490
QALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHC    491 - 560
LPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC    561 - 630
THSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPL    631 - 700
TPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDE    701 - 770
AYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR    771 - 840
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGV    841 - 910
TVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMA    911 - 980
RDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSS    981 - 1050
STRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPL   1051 - 1120
PSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGA   1121 - 1190
VENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV        1191 - 1255
//

Text Mined References (2467)

PMID Year Title