Property Summary

NCBI Gene PubMed Count 326
PubMed Score 594.43
PubTator Score 143.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung carcinoma 2843 7.3e-38
diabetes mellitus 1728 2.2e-03
breast carcinoma 1638 3.7e-02
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 111 0.0 5.0
Wegener's granulomatosis 13 0.0 5.0
Disease Target Count
Wegener Granulomatosis 4

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.200 3.7e-02
diabetes mellitus -1.200 2.2e-03
lung carcinoma -2.400 7.3e-38

Gene

PDB

3LQZ   4P4K   4P4R   4P57   4P5K   4P5M  

 GO Function (1)

Protein-protein Interaction (9)

Gene RIF (318)

AA Sequence

MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSD      1 - 70
VGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHN     71 - 140
LLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSP    141 - 210
VTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA                          211 - 258
//

Text Mined References (349)

PMID Year Title