Property Summary

NCBI Gene PubMed Count 309
Grant Count 93
R01 Count 36
Funding $43,923,759.05
PubMed Score 572.70
PubTator Score 143.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.200 0.037
diabetes mellitus -1.200 0.002
lung carcinoma -2.500 0.000

Gene

PDB

3LQZ   4P4K   4P4R   4P57   4P5K   4P5M  

 GO Function (1)

Gene RIF (305)

PMID Text
26915265 Cellular misfolded proteins rescued from degradation by MHC class II molecules seem to be involved in autoimmune diseases as a target for autoantibodies. (review)
26498496 The observed positive association between integrated HIV-1 DNA load and frequency of CD8(+)DR/DP/DQ(+) cells indicates that a close correlation between HIV persistence and immune activation continues during consistently suppressive therapy.
26462556 Our results further confirm that genetic variants in the HLA-DP locus are strongly associated with reduced HBV infection and increased the likelihood of spontaneous viral clearance.
26449183 Significant associations between chronic hepatitis B infection and five DPB1 alleles (two susceptibility alleles, DPB1(*) 05:01 and (*) 09:01, and three protective alleles, DPB1(*) 02:01, (*) 04:01, and (*) 04:02) were confirmed in Japanese individuals.
26405068 Thyroid autoimmunity is highly prevalent in type 1 diabetes mellitus patients and the risk is modulated by HLA-DRB1 and HLA-DPB1 loci.
26267621 Among recipients of HLA-DPB1-mismatched transplants from donors with the low-expression allele, recipients with the high-expression allele had a high risk of GVHD.
26197724 the HLA-DP/DQ clusters contribute independently to HBV infection, and the 3'-UTR region of HLA-DPB1 represents an important functional region involved in HBV infection
26180102 DQB1*06 and DPB1*13 have roles in modulating vaccine-induced antibody responses to affect HIV-1 acquisition
26031576 findings indicate the HLA-DPB1*13:01 and +550 A alleles are significantly associated with cervical squamous cell carcinoma (CSCC) risk in Taiwanese women; in addition, significant increase in CSCC risk was observed for HLA-DPB1*13:01-G and DPB1*02:01-A haplotypes
26010309 HLA-DPB1*04:01 may reduce the risk of tissue transglutaminase autoantibodies, an early marker of celiac disease, among DR3-DQ2 children, confirming that additional variants in the HLA region influence the risk for celiac disease autoimmunity.
More...

AA Sequence

MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSD      1 - 70
VGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHN     71 - 140
LLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSP    141 - 210
VTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA                          211 - 258
//

Text Mined References (332)

PMID Year Title
26915265 2016 [Misfolded proteins complexed with HLA class II molecules are involved in autoimmune diseases as a target for autoantibodies].
26498496 2015 During Stably Suppressive Antiretroviral Therapy Integrated HIV-1 DNA Load in Peripheral Blood is Associated with the Frequency of CD8 Cells Expressing HLA-DR/DP/DQ.
26462556 2015 Quantitative assessment of common genetic variations in HLA-DP with hepatitis B virus infection, clearance and hepatocellular carcinoma development.
26449183 2015 Effects of HLA-DPB1 genotypes on chronic hepatitis B infection in Japanese individuals.
26405068 2015 Genetics of Autoimmune Thyroiditis in Type 1 Diabetes Reveals a Novel Association With DPB1*0201: Data From the Type 1 Diabetes Genetics Consortium.
26267621 2015 High HLA-DP Expression and Graft-versus-Host Disease.
26197724 2015 Fine mapping analysis of HLA-DP/DQ gene clusters on chromosome 6 reveals multiple susceptibility loci for HBV infection.
26180102 2015 HLA class II genes modulate vaccine-induced antibody responses to affect HIV-1 acquisition.
26085212 2015 Molecular mechanism and cellular function of MHCII ubiquitination.
26031576 2015 Genetic susceptibility to cervical squamous cell carcinoma is associated with HLA-DPB1 polymorphisms in Taiwanese women.
More...