Knowledge Summary

Patent

No data available

Synonym

Accession P04437
Symbols

Gene

AA Sequence

MAMLLGASVLILWLQPDWVNSQQKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGP      1 - 70
TFLISISSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASKLTFGTGTRLQVTL      71 - 139
//

Text Mined References (1)

PMID Year Title
2426193 1986 The complete primary structure of the T-cell receptor genes from an alloreactive cytotoxic human T-lymphocyte clone.