Knowledge Summary

Patent

No data available

AA Sequence

IFASLLRAVIASICVVSSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRR      1 - 70
NSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALDSSASKIIFGSGTRLSIR              71 - 131
//

Text Mined References (1)

PMID Year Title
6440030 1984 Primary structure of human T-cell receptor alpha-chain.