Knowledge Summary

Patent

No data available

AA Sequence

MGTSLLCWMALCLLGADHADTGVSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQN      1 - 70
EAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL            71 - 133
//

Text Mined References (1)

PMID Year Title