Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P04433
Symbols L6
IGKV311

Gene

PDB

3EYQ  

AA Sequence

MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYD      1 - 70
ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWP                              71 - 115
//

Text Mined References (7)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
8223863 1993 The V kappa genes of the L regions and the repertoire of V kappa gene sequences in the human germ line.
6440122 1984 Immunoglobulin genes of different subgroups are interdigitated within the VK locus.