Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P04430 A0A0A0MT74
Symbols L1
IGKV116

Gene

AA Sequence

MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLI      1 - 70
YAASSLQSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP                            71 - 117
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
6402305 1983 Evolution of immunoglobulin V genes: evidence indicating that recently duplicated human V kappa sequences have diverged by gene conversion.
3083240 1986 Polymorphism in a kappa I primary (AL) amyloid protein (BAN).