Property Summary

NCBI Gene PubMed Count 34
Grant Count 67
R01 Count 19
Funding $10,018,835.58
PubMed Score 134.58
PubTator Score 231.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04424 E7EMI0 E9PE48 Q6LDS5 Q96HS2 ASAL
Symbols ASAL

Gene

ASL

PANTHER Protein Class (1)

PDB

1AOS   1K62  

Gene RIF (17)

PMID Text
26397737 the mechanism induced by ASL shRNA which occurred in human breast cancer may be attributed to a decrease in cyclin A2 and NO.
25778938 The clinical and biochemical course in variant forms of ASL deficiency is associated with relevant residual levels of ASL activity as well as instability of mutant ASL proteins.
24927999 Point mutation of ASS1, ASL and SLC25A13 is associated with citrullinemia.
24166829 Data show that in patients with Argininosuccinate lyase deficiency, the ASl gene is subject to several mutations, the majority are missense; some more frequent then others.
24136197 Our results suggest that ASL transcripts can contribute to the highly variable phenotype in ASA patients if expressed at high levels.
22531684 Cox regression analysis showed that ASL is an independent prognostic marker for HCC. Therefore, reduced ASL expression may be a novel maker for poor prognosis in HCC patients
21667091 analysis of mutant argininosuccinate lyase in argininosuccinic aciduria
20937351 extent of protection of ASL and delta-crystallin at different ratios of alphaA-crystallin
20739017 MDR analysis provided evidence of interaction between the genes for ASS1 and SLC25A13 on the risk of CL/P.
20739017 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV      1 - 70
AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI     71 - 140
RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG    141 - 210
VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG    211 - 280
SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI    281 - 350
STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF    351 - 420
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA                              421 - 464
//

Text Mined References (37)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26397737 2015 Argininosuccinate lyase is a potential therapeutic target in breast cancer.
25778938 2015 Unstable argininosuccinate lyase in variant forms of the urea cycle disorder argininosuccinic aciduria.
25416956 2014 A proteome-scale map of the human interactome network.
24927999 2014 [Genetic analysis of ASS1, ASL and SLC25A13 in citrullinemia patients].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166829 2014 Mutations and polymorphisms in the human argininosuccinate lyase (ASL) gene.
24136197 2013 Understanding the role of argininosuccinate lyase transcript variants in the clinical and biochemical variability of the urea cycle disorder argininosuccinic aciduria.
22531684 2012 Reduced expression of argininosuccinate lyase is closely associated with postresectional survival in hepatocellular carcinoma: an immunohistochemistry study of 61 cases.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...