Property Summary

NCBI Gene PubMed Count 55
PubMed Score 896.14
PubTator Score 69.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Dystonia 163 4.593 2.3
Leukodystrophy 55 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.800 5.1e-06
astrocytic glioma -2.000 4.3e-03
Astrocytoma, Pilocytic -2.300 2.2e-05
atypical teratoid / rhabdoid tumor -2.900 1.3e-06
colon cancer -3.200 2.4e-02
ependymoma -2.900 1.7e-02
glioblastoma -3.200 1.6e-07
group 3 medulloblastoma -5.300 5.0e-07
malignant mesothelioma 2.300 6.9e-07
medulloblastoma, large-cell -2.900 7.6e-05
oligodendroglioma -1.900 7.6e-11
ovarian cancer 1.400 1.2e-09
Pick disease -1.300 3.0e-02
primitive neuroectodermal tumor -2.000 1.5e-02
psoriasis -1.300 7.1e-25
subependymal giant cell astrocytoma -4.359 2.2e-02

Gene RIF (32)

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEGEFEEEAEEEVA                                                  421 - 444
//

Text Mined References (58)

PMID Year Title