Property Summary

NCBI Gene PubMed Count 18
Grant Count 38
R01 Count 25
Funding $15,890,684.5
PubMed Score 128.44
PubTator Score 55.98

Knowledge Summary

Patent

No data available

AA Sequence

MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG      1 - 70
PPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG     71 - 140
PPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQ    141 - 210
SPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKP    211 - 280
QGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEG    281 - 350
NNPQGPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ                                351 - 392
//

Text Mined References (21)

PMID Year Title
20879038 2010 Finding new posttranslational modifications in salivary proline-rich proteins.
18463091 2008 Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11422372 2001 Proteolytic processing of a human salivary proline-rich protein precursor by proprotein convertases.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9796777 1998 Encoding of human basic and glycosylated proline-rich proteins by the PRB gene complex and proteolytic processing of their precursor proteins.
9487127 1998 Enhanced glycosylation and sulfation of secretory proteoglycans is coupled to the expression of a basic secretory protein.
8422499 1993 The structure and evolution of the human salivary proline-rich protein gene family.
8317492 1993 PRBI gene variants coding for length and null polymorphisms among human salivary Ps, PmF, PmS, and Pe proline-rich proteins (PRPs).
7118863 1982 Fractionation and characterization of basic proline-rich peptides of human parotid saliva and the amino acid sequence of proline-rich peptide P-E.
More...