Property Summary

NCBI Gene PubMed Count 18
PubMed Score 133.05
PubTator Score 55.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

AA Sequence

MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG      1 - 70
PPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG     71 - 140
PPPQGDKSQSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQ    141 - 210
SPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKP    211 - 280
QGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEG    281 - 350
NNPQGPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ                                351 - 392
//

Text Mined References (21)

PMID Year Title