Property Summary

NCBI Gene PubMed Count 62
Grant Count 92
R01 Count 21
Funding $14,163,705.83
PubMed Score 265.61
PubTator Score 28.00

Knowledge Summary

Patent

No data available

Synonym

Accession P04279 Q53ZV0 Q53ZV1 Q53ZV2 Q6X4I9 Q6Y809 Q6Y822 Q6Y823 Q86U64 Q96QM3
Symbols SGI
SEMG
CT103
dJ172H20.2

Gene

Gene RIF (31)

PMID Text
25631074 Cellular biotinylated semenogelin I protein (SEMG1) is incorporated into HIV-1 Gag virus-like particles
25027395 Data indicate that semenogelin I (Sg I) expression has potential value in predicting renal cell carcinoma (RCC) progression and prognosis, suggesting the use of Sg I as a biomarker for RCC.
24811874 Three regions of SEM1(86-107) comprise the amyloid fibril core that enhances HIV-1 infection.
24312623 EPPIN and SEMG1 rapidly co-evolved in primates
23289976 SEMG1 was significantly changed in asthenozoosperm, which could be the candidate gene for the development of diagnostic marker and provided the opportunity to further illustrate the biological mechanisms of asthenozoospermia.
23085372 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma
22699487 EPPIN's semenogelin I binding site: a contraceptive drug target.
22617231 Nuclear semenogelin I expression could be a reliable prognosticator in men who undergo radical prostatectomy.
22177559 Peptides released by physiological cleavage of Semg1 and Semg2 form amyloids that enhance HIV infection.
21557275 These results suggest the involvement of semenogelins in prostate cancer and their prognostic values in predicting cancer progression after radical prostatectomy.
More...

AA Sequence

MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYH      1 - 70
VDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQ     71 - 140
NPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRET    141 - 210
KNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHG    211 - 280
RKANKISYQSSSTEERRLHYGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS    281 - 350
SSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH    351 - 420
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT                                421 - 462
//

Text Mined References (62)

PMID Year Title
25027395 2014 Seminal plasma protein in renal cell carcinoma: expression of semenogelin I is a predictor for cancer progression and prognosis.
24811874 2014 Structural characterization of semen coagulum-derived SEM1(86-107) amyloid fibrils that enhance HIV-1 infection.
24312623 2013 Interacting proteins on human spermatozoa: adaptive evolution of the binding of semenogelin I to EPPIN.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23289976 2014 SEMG1 may be the candidate gene for idiopathic asthenozoospermia.
23085372 2013 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma.
22699487 2012 Characterization of EPPIN's semenogelin I binding site: a contraceptive drug target.
22617231 2012 Seminal plasma proteins in prostatic carcinoma: increased nuclear semenogelin I expression is a predictor of biochemical recurrence after radical prostatectomy.
22177559 2011 Peptides released by physiological cleavage of semen coagulum proteins form amyloids that enhance HIV infection.
22075473 2012 Loss of calcium in human spermatozoa via EPPIN, the semenogelin receptor.
More...