Property Summary

NCBI Gene PubMed Count 62
PubMed Score 271.13
PubTator Score 28.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 2.2e-04

Gene RIF (31)

AA Sequence

MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYH      1 - 70
VDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQ     71 - 140
NPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRET    141 - 210
KNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHG    211 - 280
RKANKISYQSSSTEERRLHYGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS    281 - 350
SSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH    351 - 420
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT                                421 - 462
//

Text Mined References (62)

PMID Year Title