Property Summary

NCBI Gene PubMed Count 243
Grant Count 405
R01 Count 237
Funding $59,679,377.04
PubMed Score 5188.32
PubTator Score 4044.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (199)

Disease Z-score Confidence
Polycystic Ovary Syndrome 332 7.396 3.7
Hyperandrogenism 32 6.891 3.4
Hypogonadism 70 6.114 3.1
Obesity 616 5.578 2.8
Anovulation 20 5.346 2.7
Sexual dysfunction 10 5.264 2.6
Metabolic syndrome X 155 5.172 2.6
Hyperinsulinism 63 5.015 2.5
diabetes mellitus 1,663 4.947 2.5
Cancer 2,346 4.933 2.5
Amenorrhea 60 4.915 2.5
Acne 20 4.781 2.4
Infertility 163 4.76 2.4
Hyperthyroidism 50 4.428 2.2
Klinefelter's syndrome 59 4.317 2.2
Osteoporosis 257 4.316 2.2
Hypothyroidism 89 4.311 2.2
Acanthosis nigricans 14 4.293 2.1
Seborrheic dermatitis 19 4.209 2.1
Gynecomastia 13 4.105 2.1
Male infertility 170 4.078 2.0
Hyperprolactinemia 22 4.054 2.0
Hypoactive sexual desire disorder 9 3.99 2.0
Alopecia 55 3.982 2.0
Ovarian dysfunction 19 3.656 1.8
Premature ovarian failure 64 3.649 1.8
Cryptorchidism 67 3.615 1.8
Lipid metabolism disorder 102 3.53 1.8
Thyrotoxicosis 38 3.522 1.8
Hypertension 287 3.5 1.8
Androgen insensitivity syndrome 11 3.463 1.7
Coronary artery disease 240 3.456 1.7
Varicocele 21 3.453 1.7
Liver disease 219 3.393 1.7
Epilepsy 346 3.344 1.7
Prostatic hypertrophy 9 3.23 1.6
Atherosclerosis 275 3.133 1.6
Acne vulgaris 16
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Advanced Prostatic Carcinoma 5
Alcoholic Intoxication, Chronic 41
Allergic conjunctivitis 25
Allergic rhinitis 91
Amenorrhea Secondary to Ovarian Dysfunct... 8 
Anemia of chronic renal failure 4
Angioedema 36
Ankylosing spondylitis 138
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma 349
Atopic dermatitis 944
Atrophic vaginitis 14
Atrophic vulva 6
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial keratitis 5
Berylliosis 16
Bilateral Anorchia 3
Bilateral orchidectomy 3
Blepharoconjunctivitis 5
Breast cancer 3,094 2.0
Bursitis 10
Catabolic Process 2
Cerebral edema 5
Chemotherapy-Induced Hypogonadism 3
Chemotherapy-induced nausea and vomiting 18
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Contraception 15
Corneal abrasion 6
Corneal ulcer 9
Corpus Luteum Insufficiency Syndrome 8
Crohn's disease 304
Cyclitis 6
Deficiency of testosterone biosynthesis 3
Delayed Puberty 10
Dermatitis herpetiformis 11
Diabetes Mellitus, Non-Insulin-Dependent 157
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Dysfunctional uterine bleeding 9
Dyspareunia 3
Edema of larynx 5
Endometrial Hyperplasia Prevention 9
Endometrial carcinoma 18
Endometriosis 535
Epicondylitis 19
Erectile dysfunction 10
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Female hypogonadism syndrome 7
Fibrocystic breast changes 3
Follicular non-Hodgkin's lymphoma 17
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Hereditary Angioedema Prevention 3
Herpes zoster keratitis 6
Hodgkin's disease 18
Hormone receptor positive malignant neop... 10 
Humoral hypercalcemia of malignancy 6
Hypogonadotropic hypogonadism 4
Hypopituitarism 36
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spira... 3 
Infective blepharitis 5
Infective otitis externa 4
Infertility Secondary to Progesterone De... 8 
Inflammatory bowel disease 142
Inflammatory dermatosis 38
Inhibition of lactation procedure 3
Iridocyclitis 12
Iritis 9
Itching of ear 3
Juvenile rheumatoid arthritis 104
Keratitis 42
Klinefelter's syndrome, XXY 3
LHRH Deficiency 3
Lichen simplex chronicus 7
Lymphatic Metastasis 14
Löffler's syndrome 5
Male hypogonadism 3
Malignant otitis externa due to Pseudomo... 4 
Mastoidectomy Cavity Infections 3
Menopausal flushing 17
Menorrhagia 8
Metastatic Breast Carcinoma 21
Metastatic Prostate Carcinoma 18
Miliary tuberculosis 5
Minor Bacterial Skin Infections 3
Multiple Sclerosis 498
Mycosis fungoides 28
Neoplasm Invasiveness 127
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Otitis externa 9
Pemphigus 18
Plaque psoriasis 14
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Postcoital contraception 2
Postmenopausal osteoporosis 19
Premenstrual dysphoric disorder 8
Prevention of Post-Operative Nausea and ... 14 
Prevention of Premature Labor 9
Prevention of Radiation-Induced Nausea a... 7 
Primary Hypogonadism due to Bilateral To... 3 
Primary Hypogonadism due to Orchitis 3
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 24
Primary ovarian failure 5
Proctitis 11
Prostate cancer 172 2.0
Prostatic Neoplasms 471
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate Epithelial Keratopathy 6
Punctate keratopathy 3
Recurrent herpes simplex labialis 3
Rheumatic heart disease 8
Rheumatoid Arthritis 1,160
Rosacea 18
Scalp psoriasis 6
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 9
Severe adrenal insufficiency 5
Staphylococcus Aureus Otitis Externa 4
Superficial Ocular Infection 6
Synovitis 38
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Tinea corporis 25
Tinea cruris 12
Tinea pedis 30
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protei... 5 
Transplanted organ rejection 10
Undescended testicle 3
Urethral atrophy 4
Uveitis 103
psoriasis 6,685
sarcoidosis 358
systemic lupus erythematosus 156
ulcerative colitis 2,087

Expression

Synonym

Accession P04278 B0FWH4 E9PGW1 F5H5Z8 I3L1N7 P14689 Q16616 Q3MIL0 Q6ISD2 SHBG
Symbols ABP
SBP
TEBG

Gene

PDB

1D2S   1F5F   1KDK   1KDM   1LHN   1LHO   1LHU   1LHV   1LHW  

Gene RIF (247)

PMID Text
26963243 overlapping of interacting amino acid residues between phthalate compounds and natural ligand, dihydrotestosterone, suggested potential disrupting activity of phthalates in the endocrine homeostasis function of SHBG
26778261 higher SHBG (but not testosterone or estradiol) is an independent risk factor for vertebral fractures in older men.
26700933 We found that elevated levels of estradiol and SHBG in HT [Hormone therapy] users were associated with elevated levels of CRP and lower levels of TFPI, both of which may be related to a prothrombotic milieu in HT [Hormone therapy ]users.
26680482 There was a drop in SHBG levels in the first week of smoking cessation and levels continued to remain low.
26600064 Specific SHBG variants affecting serum SHBG levels and SHBG haplotypes are associated with polycystic ovary syndrome, suggesting the role for SHBG as polycystic ovary syndrome candidate gene.
26483395 prognostic role of testosterone in men with type 2 diabetes mellitus (T2DM) is influenced by its carrier protein sex hormone-binding globulin
26441241 SHBG overexpression reduced weight gain but did not change the metabolic profile of obese mice. SHBG down-regulation during obesity development involved changes in liver HNF4alpha and PPARgamma mRNA and protein levels.
26291814 SHBG was higher in both obese and non-obese PCOS patients compared to healthy controls.
26181566 preoperative serum SHBG level is an independent predictor of postoperative biochemical recurrence-free survival after radical prostatectomy
25647406 significant association between rs1799941 in SHBG gene and MetS in children
More...

AA Sequence

MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTS      1 - 70
SSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS     71 - 140
VLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASA    141 - 210
PTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLH    211 - 280
LQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLG    281 - 350
ALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH                      351 - 402
//

Text Mined References (245)

PMID Year Title
26963243 2016 Endocrine Disruption: Computational Perspectives on Human Sex Hormone-Binding Globulin and Phthalate Plasticizers.
26778261 2016 Sex hormones, sex hormone binding globulin, and vertebral fractures in older men.
26700933 2016 Association of Serum Sex Hormones with Hemostatic Factors in Women On and Off Hormone Therapy: The Multiethnic Study of Atherosclerosis.
26680482 2015 The steroid spectrum during and after quitting smoking.
26600064 2016 Common Variants in the Sex Hormone-Binding Globulin (SHBG) Gene Influence SHBG Levels in Women with Polycystic Ovary Syndrome.
26483395 2016 Association of sex hormone-binding globulin and free testosterone with mortality in men with type 2 diabetes mellitus.
26441241 2015 SHBG-C57BL/ksJ-db/db: A New Mouse Model to Study SHBG Expression and Regulation During Obesity Development.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26181566 2015 Preoperative Serum Sex Hormone-Binding Globulin Level Is an Independent Predictor of Biochemical Outcome After Radical Prostatectomy.
25647406 2015 SHBG gene polymorphism (rs1799941) associates with metabolic syndrome in children and adolescents.
More...