Property Summary

NCBI Gene PubMed Count 323
Grant Count 1,356
R01 Count 681
Funding $357,108,556.47
PubMed Score 3042.94
PubTator Score 5346.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Down syndrome 1.500 0.000
psoriasis -1.300 0.000
sonic hedgehog group medulloblastoma -4.100 0.000
atypical teratoid/rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.900 0.000
colon cancer -3.600 0.000
interstitial cystitis 2.000 0.000
non-inflammatory breast cancer -3.000 0.000
breast carcinoma -1.500 0.000
ductal carcinoma in situ -3.900 0.000
invasive ductal carcinoma -5.200 0.000
pituitary cancer -1.400 0.037

Synonym

Accession P04271 D3DSN6
Symbols NEF
S100
S100-B
S100beta

Gene

PDB

1MQ1   2M49   4XYN   5D7F   5CSF   5CSI   5CSJ   5CSN   1UWO   2H61   2PRU   3CZT   3D0Y   3D10   3HCM  

 GWAS Trait (1)

Gene RIF (284)

PMID Text
27007976 There was no association found between serum and CSF S100B with radiographic vasospasm or DIND. S100B is a potential prognostic marker for aSAH outcome
26819111 Serum S100B is a useful quantitative biomarker in routine follow-up of high-risk melanoma patients.
26600537 Our results support the hypothesis that S-100beta is an important biological indicator of HIE and serum S-100beta levels can be used as a reference index to assess hypoxic-ischemic encephalopathy severity.
26421286 This study inquires into the physiological concentrations of NSE and S100B proteins in CSF, carried out on a sufficiently large group of 601 patients.
26417594 Studied circulating S100B and adiponectin in children who underwent open heart surgery. S100B showed a significant increase from hospital admission up to 24 h after procedure.
26401738 Concentrations of serum S100B protein in brain-dead organ donors are extremely high and may support the diagnosis of brain death.
26316432 long-term exposure to high blood glucose concentrations leads to an increase in total oxidant in patients with diabetic ketoacidosis ( and that the neurotransmitter changes that develop in response to this exposure lead to an increase in S100B levels
26148794 Levels of S100B below can accurately predict normal Cranial CT findings after minor head injury
26116899 HIV-1 Vpr upregulates the gene expression of S100B in human monocyte-derived dendritic cells
26040109 results suggested the use of serum S-100beta and NSE levels as indicators for brain injury
More...

AA Sequence

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD      1 - 70
FQEFMAFVAMVTTACHEFFEHE                                                     71 - 92
//

Text Mined References (325)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27007976 2016 Association between S100B Levels and Long-Term Outcome after Aneurysmal Subarachnoid Hemorrhage: Systematic Review and Pooled Analysis.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26819111 2016 Biomarker value and pitfalls of serum S100B in the follow-up of high-risk melanoma patients.
26600537 2015 Serum levels of S-100? correlate with the clinical status and severity of hypoxic-ischemic encephalopathy in neonates.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26421286 2015 Biomarkers of Brain Damage: S100B and NSE Concentrations in Cerebrospinal Fluid--A Normative Study.
26417594 2015 Circulating S100B and Adiponectin in Children Who Underwent Open Heart Surgery and Cardiopulmonary Bypass.
26401738 2015 Serum S100B protein concentration in brain-dead organ donors: a pilot study.
26316432 2015 Evaluation of Pre-Treatment and Post-Treatment S100B, Oxidant and Antioxidant Capacity in Children with Diabetic Ketoacidosis.
More...