Property Summary

NCBI Gene PubMed Count 90
Grant Count 45
R01 Count 30
Funding $4,854,762.64
PubMed Score 255.52
PubTator Score 653.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -2.700 0.020
osteosarcoma -2.435 0.007
periodontitis -1.200 0.000

Gene RIF (29)

PMID Text
26343611 These findings indicate that exogenous FABP4 interacts with plasma membrane proteins, specifically CK1.
26181054 Complete structure of an epithelial keratin 1/keratin 10 dimer has been presented.
25808222 In our study, the missense mutation in the proband and his mother with epidermolytic ichthyosis was a single amino acid difference in codon 478, which causes more serious skin manifestations
25774499 In ichthyosis with confetti, a causal de novo KRT1 mutation had a C-terminal frameshift, replacing 22 C-terminal AAs with an alternate 30-AA peptide. It distorted the IF network and mislocalized to the nucleus. Reversion occurred by mitotic recombination.
25605727 In HeLa cells transiently expressing C2GnT-M-GFP, knockdown of KRT1 does not affect Golgi morphology but leaves C2GnT-M outside of the Golgi, resulting in the formation of sialyl-T antigen.
25429721 analysis of a heterozygous novel splice junction mutation in the 2B domain of KRT1 in a family with diffuse palmoplantar keratoderma
25073515 Decreased levels of cytokeratin-1 is associated with breast cancer.
25050384 Hsp74, a potential bladder cancer marker, has direct interaction with keratin 1.
23707440 identified among endothelial antigens to which antibodies are produced during heart transplant rejection
23623204 Case Report/Letter: specific mutation in 2B domain of KRT1 gives rise to mild phenotype of epidermolytic hyperkeratosis mimicking ichthyosis bullosa of Siemens.
More...

AA Sequence

MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGGGFGSRSLVNL      1 - 70
GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYG     71 - 140
GGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSREREQIKSLNNQFASFIDKVRFLEQQNQVLQT    141 - 210
KWELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNA    211 - 280
ENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSI    281 - 350
IAEVKAQYEDIAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS    351 - 420
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEE    421 - 490
SRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG    491 - 560
SGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGGSS    561 - 630
SVKFVSTTYSGVTR                                                            631 - 644
//

Text Mined References (105)

PMID Year Title
26343611 2015 New insights into circulating FABP4: Interaction with cytokeratin 1 on endothelial cell membranes.
26181054 2015 Complete Structure of an Epithelial Keratin Dimer: Implications for Intermediate Filament Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25808222 2015 A KRT1 gene mutation related to epidermolytic ichthyosis in a Chinese family.
25774499 2015 Frequent somatic reversion of KRT1 mutations in ichthyosis with confetti.
25605727 2015 Keratin 1 plays a critical role in golgi localization of core 2 N-acetylglucosaminyltransferase M via interaction with its cytoplasmic tail.
25429721 2015 Next-generation sequencing detection and characterization of a heterozygous novel splice junction mutation in the 2B domain of KRT1 in a family with diffuse palmoplantar keratoderma.
25073515 2014 Circulating levels and clinical implications of epithelial membrane antigen and cytokeratin-1 in women with breast cancer: can their ratio improve the results?
25050384 2014 Hsp74, a potential bladder cancer marker, has direct interaction with keratin 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...