Property Summary

NCBI Gene PubMed Count 90
PubMed Score 255.52
PubTator Score 653.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -2.700 0.020
osteosarcoma -2.435 0.007
periodontitis -1.200 0.000

Synonym

Accession P04264 B2RA01 P85925 P86104 Q14720 Q6GSJ0 Q9H298
Symbols K1
CK1
EHK
EHK1
EPPK
KRT1A
NEPPK

Gene

PDB

4ZRY  

  Ortholog (6)

Gene RIF (29)

PMID Text
26343611 These findings indicate that exogenous FABP4 interacts with plasma membrane proteins, specifically CK1.
26181054 Complete structure of an epithelial keratin 1/keratin 10 dimer has been presented.
25808222 In our study, the missense mutation in the proband and his mother with epidermolytic ichthyosis was a single amino acid difference in codon 478, which causes more serious skin manifestations
25774499 In ichthyosis with confetti, a causal de novo KRT1 mutation had a C-terminal frameshift, replacing 22 C-terminal AAs with an alternate 30-AA peptide. It distorted the IF network and mislocalized to the nucleus. Reversion occurred by mitotic recombination.
25605727 In HeLa cells transiently expressing C2GnT-M-GFP, knockdown of KRT1 does not affect Golgi morphology but leaves C2GnT-M outside of the Golgi, resulting in the formation of sialyl-T antigen.
25429721 analysis of a heterozygous novel splice junction mutation in the 2B domain of KRT1 in a family with diffuse palmoplantar keratoderma
25073515 Decreased levels of cytokeratin-1 is associated with breast cancer.
25050384 Hsp74, a potential bladder cancer marker, has direct interaction with keratin 1.
23707440 identified among endothelial antigens to which antibodies are produced during heart transplant rejection
23623204 Case Report/Letter: specific mutation in 2B domain of KRT1 gives rise to mild phenotype of epidermolytic hyperkeratosis mimicking ichthyosis bullosa of Siemens.
More...

AA Sequence

MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGGGFGSRSLVNL      1 - 70
GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYG     71 - 140
GGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSREREQIKSLNNQFASFIDKVRFLEQQNQVLQT    141 - 210
KWELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNA    211 - 280
ENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSI    281 - 350
IAEVKAQYEDIAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS    351 - 420
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEE    421 - 490
SRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG    491 - 560
SGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGGSS    561 - 630
SVKFVSTTYSGVTR                                                            631 - 644
//

Text Mined References (105)

PMID Year Title
26343611 2015 New insights into circulating FABP4: Interaction with cytokeratin 1 on endothelial cell membranes.
26181054 2015 Complete Structure of an Epithelial Keratin Dimer: Implications for Intermediate Filament Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25808222 2015 A KRT1 gene mutation related to epidermolytic ichthyosis in a Chinese family.
25774499 2015 Frequent somatic reversion of KRT1 mutations in ichthyosis with confetti.
25605727 2015 Keratin 1 plays a critical role in golgi localization of core 2 N-acetylglucosaminyltransferase M via interaction with its cytoplasmic tail.
25429721 2015 Next-generation sequencing detection and characterization of a heterozygous novel splice junction mutation in the 2B domain of KRT1 in a family with diffuse palmoplantar keratoderma.
25073515 2014 Circulating levels and clinical implications of epithelial membrane antigen and cytokeratin-1 in women with breast cancer: can their ratio improve the results?
25050384 2014 Hsp74, a potential bladder cancer marker, has direct interaction with keratin 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...