Property Summary

NCBI Gene PubMed Count 17
PubMed Score 114.77
PubTator Score 63.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 3.358 7.1e-05
active ulcerative colitis 2.143 2.8e-02
Breast cancer -4.700 5.3e-12
breast carcinoma -1.400 1.8e-07
cutaneous lupus erythematosus 2.200 3.6e-06
cystic fibrosis 2.800 5.5e-07
ductal carcinoma in situ 2.100 3.0e-02
esophageal adenocarcinoma -3.600 3.5e-02
intraductal papillary-mucinous neoplasm ... 6.000 5.4e-04
non-small cell lung cancer 5.098 2.5e-12
ovarian cancer 1.200 2.9e-05
pancreatic cancer 1.800 1.5e-02
psoriasis 1.100 4.7e-05
spina bifida -1.890 5.0e-02

Gene RIF (4)

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQ    421 - 490
STVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (20)

PMID Year Title