Property Summary

NCBI Gene PubMed Count 17
Grant Count 104
R01 Count 76
Funding $9,549,681.87
PubMed Score 107.62
PubTator Score 63.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -3.600 0.035
psoriasis 3.100 0.000
cutaneous lupus erythematosus 2.200 0.000
non-small cell lung cancer 5.098 0.000
intraductal papillary-mucinous neoplasm ... 6.000 0.001
active Crohn's disease 3.358 0.000
ulcerative colitis 3.900 0.000
pancreatic cancer 1.800 0.015
cystic fibrosis 2.800 0.000
Breast cancer -4.700 0.000
breast carcinoma -1.400 0.000
spina bifida -1.890 0.050
ductal carcinoma in situ 2.100 0.030
ovarian cancer 1.200 0.000

Synonym

Accession P04259 P48669
Symbols K6B
PC2
PC4
CK6B
CK-6B
KRTL1

Gene

Gene RIF (4)

PMID Text
26464664 These results suggested that the upregulation of notch1 and KRT6B might be involved in the development, progression and prognosis of human renal cell carcinoma
23075894 Data show that calretinin and CK5/6 were positive in 100 and 64% of mesotheliomas, and 92 and 31% of reactive effusions, respectively, and desmin was negative in all malignant cases and positive in 85% of reactive effusions.
22264670 We found that the KRT16 mutation carriers developed plantar keratoderma at a similar age to KRT6a carriers wheras KRT6B and KRT17 carriers were significantly more likely to report later onset.
19720911 Studies show that the intrinsic molecular signature of five markers, ER, PR, HER-2, CK 5/6, and EGFR, demonstrated specificity of 100% and sensitivity of 75%, compared with classification by gene expression profiling.

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQ    421 - 490
STVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (20)

PMID Year Title
26464664 2015 KRT6 interacting with notch1 contributes to progression of renal cell carcinoma, and aliskiren inhibits renal carcinoma cell lines proliferation in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
23075894 2012 The diagnostic utility of D2-40, calretinin, CK5/6, desmin and MOC-31 in the differentiation of mesothelioma from adenocarcinoma in pleural effusion cytology.
22264670 2012 A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita.
21326300 2011 A large mutational study in pachyonychia congenita.
19720911 2009 Prediction of local recurrence, distant metastases, and death after breast-conserving therapy in early-stage invasive breast cancer using a five-biomarker panel.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16250206 2005 The genetic basis of pachyonychia congenita.
More...