Property Summary

NCBI Gene PubMed Count 70
PubMed Score 243.36
PubTator Score 98.96

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 0.002
osteosarcoma -3.044 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.022
lung cancer -1.700 0.001
interstitial cystitis 1.800 0.001
primary Sjogren syndrome 2.300 0.001
lung adenocarcinoma -1.215 0.000
psoriasis 1.300 0.000
lung carcinoma -1.600 0.000
invasive ductal carcinoma 1.100 0.040


Accession P04234 A8MVP6
Symbols T3D




  Ortholog (11)

 CSPA Cell Line (2)

Gene RIF (64)

26437631 A FOXP3(+)CD3(+)CD56(+)-expressed T-cell population with immunosuppressive function and reduced patient survival has been identified in cancer tissues of human hepatocellular carcinoma.
26109064 The docking site for CD3 subunits on the T Cell receptor beta chain has been identified by solution NMR.
25505066 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25422432 analysis of the molecular organization of the TCR-CD3 complex
24495362 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
24288697 Two cases of SCID with CD3delta gene mutation in Mexican Mennonite infants are described.
24187576 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
23336327 The surface TCR expression of primary alphabeta and gammadelta T cells from healthy donors carrying a single null or leaky mutation in CD3G (gamma+/-) or CD3D (delta+/-, delta+/leaky) with that of normal controls, were compared.
22911005 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells

AA Sequence

ALLRNDQVYQPLRDRDDAQYSHLGGNWARNK                                           141 - 171

Text Mined References (73)

PMID Year Title
26437631 2015 Identification of a FOXP3(+)CD3(+)CD56(+) population with immunosuppressive function in cancer tissues of human hepatocellular carcinoma.
26109064 2015 Identification of the Docking Site for CD3 on the T Cell Receptor ? Chain by Solution NMR.
25422432 2014 Molecular architecture of the ?? T cell receptor-CD3 complex.
24288697 The respiratory presentation of severe combined immunodeficiency in two Mennonite children at a tertiary centre highlighting the importance of recognizing this pediatric emergency.
23336327 2013 Human CD3?, but not CD3?, haploinsufficiency differentially impairs ?? versus ?? surface TCR expression.
22401598 2012 Altered expression of the TCR signaling related genes CD3 and Fc?RI? in patients with aplastic anemia.
21984702 2011 Epidermal CCR6+ ?? T cells are major producers of IL-22 and IL-17 in a murine model of psoriasiform dermatitis.
21926461 2011 A leaky mutation in CD3D differentially affects ?? and ?? T cells and leads to a T??-T??+B+NK+ human SCID.
21883749 2011 Genotype, phenotype, and outcomes of nine patients with T-B+NK+ SCID.
21670311 2011 Stimulated ?? T cells increase the in vivo efficacy of trastuzumab in HER-2+ breast cancer.