Property Summary

Ligand Count 2
NCBI Gene PubMed Count 73
PubMed Score 251.20
PubTator Score 98.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 1.6e-03
interstitial cystitis 1.800 1.4e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
invasive ductal carcinoma 1.100 4.0e-02
lung adenocarcinoma -1.215 1.8e-04
lung cancer -1.700 8.7e-04
lung carcinoma -1.600 1.5e-13
osteosarcoma -3.044 4.0e-05
primary Sjogren syndrome 2.300 1.0e-03
psoriasis 1.300 3.1e-09

 OMIM Phenotype (1)

 GWAS Trait (1)

 CSPA Cell Line (2)

Gene RIF (67)

AA Sequence

MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGI      1 - 70
YRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQ     71 - 140
ALLRNDQVYQPLRDRDDAQYSHLGGNWARNK                                           141 - 171
//

Text Mined References (80)

PMID Year Title