Property Summary

Ligand Count 7
NCBI Gene PubMed Count 126
PubMed Score 286.25
PubTator Score 193.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 2.467 3.3e-03
active ulcerative colitis 2.570 4.6e-03
acute myeloid leukemia 1.200 4.1e-02
adrenocortical carcinoma -1.642 2.2e-02
adult high grade glioma 2.100 1.5e-02
astrocytic glioma 1.900 1.1e-02
Astrocytoma, Pilocytic 2.600 6.0e-05
atypical teratoid / rhabdoid tumor 1.500 2.1e-03
Becker muscular dystrophy 1.160 1.2e-03
Breast cancer 1.300 3.3e-02
Down syndrome 1.800 9.2e-04
Duchenne muscular dystrophy 1.553 2.3e-09
ependymoma 1.700 4.3e-02
esophageal adenocarcinoma 1.400 1.9e-02
glioblastoma 1.100 2.3e-02
interstitial cystitis 1.500 1.7e-02
invasive ductal carcinoma 1.479 2.5e-03
juvenile dermatomyositis 1.453 5.5e-08
limb girdle muscular dystrophy 2A 1.029 8.6e-05
lung cancer -2.100 1.3e-05
lung carcinoma -2.700 4.7e-43
non-small cell lung cancer -1.217 4.0e-06
osteosarcoma -1.863 4.6e-02
ovarian cancer -1.200 1.7e-02
pancreatic ductal adenocarcinoma liver m... 2.313 2.4e-03
primary Sjogren syndrome 2.100 5.0e-02
psoriasis -1.600 3.8e-03
Rheumatoid arthritis -2.900 1.4e-03
subependymal giant cell astrocytoma 2.101 4.6e-03

Protein-protein Interaction (2)

Gene RIF (110)

AA Sequence

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF      1 - 70
LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED     71 - 140
HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL    141 - 210
TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP    211 - 280
SSGLGVTKQDLGPVPM                                                          281 - 296
//

Text Mined References (135)

PMID Year Title