Property Summary

NCBI Gene PubMed Count 115
Grant Count 93
R01 Count 59
Funding $11,687,517.19
PubMed Score 272.62
PubTator Score 193.65

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04233 A8K7R1 B4DNE8 D3DQG3 D3DQG4 Q14597 Q29832 Q5U0J8 Q8SNA0 Q8WLP6
Symbols II
DHLAG
HLADG
Ia-GAMMA

Gene

PDB

1A6A   3PDO   3PGC   3PGD   3QXA   3QXD   4AEN   4AH2   4X5W   1ICF   1IIE   1L3H   1MUJ  

Gene RIF (114)

PMID Text
27033518 Studies indicate that the invariant chain (CD74) is critical for antigen presentation.
26500140 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74.
26412712 an inverse correlation with the tumor size for stromal MIF and a positive correlation with the triple receptor negative tumor status for stromal CD74 seem to be showed
26198699 Invariant chain is a new chaperone for TLR7 in B cells. (Review)
26039541 Interferon gamma promotes melanoma cell survival regulating CD74-MIF interaction.
25998395 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25998395 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25983110 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2.
25600560 CD74 expression and its therapeutic potential in thyroid carcinoma
25304249 Specific targeting of the CD74 on the lymphoma cell surface will sensitize CD74-expressing cancer cells to Fas-mediated apoptosis.
More...

AA Sequence

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF      1 - 70
LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED     71 - 140
HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL    141 - 210
TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP    211 - 280
SSGLGVTKQDLGPVPM                                                          281 - 296
//

Text Mined References (124)

PMID Year Title
27033518 2016 The multifaceted roles of the invariant chain CD74--More than just a chaperone.
26500140 2016 FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas.
26412712 2015 Macrophage migration inhibitory factor involvement in breast cancer (Review).
26198699 2015 Invariant chain is a new chaperone for TLR7 in B cells.
26039541 2015 Cell Surface CD74-MIF Interactions Drive Melanoma Survival in Response to Interferon-?.
25983110 2015 A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25600560 2015 CD74 expression and its therapeutic potential in thyroid carcinoma.
25304249 2014 CD74 interferes with the expression of fas receptor on the surface of lymphoma cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...